KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2734Help
Entry
cg2734            CDS       T00244                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cgb00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2604217..2604777
Genome map
AA seq 186 aa AA seqDB search
MARALILVDVQKDFCPGGSLATERGDEVAGKIGAYQLSHGSEYDVVVATQDWHIDPGEHF
SETPDFKNSWPIHCVADSDGAAMHDRINTDSIDEFFRKGHYTAAYSGFEGTAVSEELLMS
PWLKNKGVTDVDIVGIATDHCVRATALDALKEGFNVSILTSMCSAVDFHAGDHALEELHE
AGAILI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgcactcattctggttgatgttcaaaaagacttctgccccggtggcagccta
gccaccgaacgaggcgatgaagtggcgggaaaaatcggtgcctatcagctgtcccacggc
tcagagtacgacgtcgttgtggcgacccaagattggcacatcgatccaggcgagcacttt
tcagaaaccccagactttaaaaactcctggccaatccactgcgtcgcggattccgatggt
gccgccatgcatgaccgcatcaacaccgattcaatcgatgagttcttccgcaaaggccat
tacaccgcggcgtattccgggttcgagggaactgcagtcagtgaagaactcctcatgtct
ccatggctgaagaacaagggagtcactgatgtagacatcgtagggatcgctacggatcac
tgcgttcgagccacagcacttgatgctctcaaggagggcttcaacgtctccattttgacg
tcgatgtgttctgcggtggatttccatgcgggagaccacgctttggaggaactacatgaa
gccggggcgattctgatttaa

DBGET integrated database retrieval system