KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2829Help
Entry
cg2829            CDS       T00244                                 

Gene name
murA2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cgb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cgb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2690104..2691369)
Genome map
AA seq 421 aa AA seqDB search
MGHVKDKFLVTGGAQLQGAVKVYGAKNSVLKLMAAALLAEGTTTLTNCPEILDVPLMRDV
LVGLGCDVTIDGSTVTITTPAELSSNADFPAVTQFRASVCVLGPLTARCGRAVVSLPGGD
AIGSRPLDMHQSGLEKLGATTRISHGAVVAEAEKLVGANITLDFPSVGATENILTASVMA
EGRTVLDNAAREPEIVDLCRMLRSMGANIEGEGSPTITIEGVEKLTPTQHEVIGDRIVAG
TWAYAAAMTRGDITVGGIAPRYLHLPLEKLKIAGAKVETYENGFRVQMDKQPEATDYQTL
PFPGFPTDLQPMAIGINAVSNGTSVITENVFESRFRFVDEMLRLGADANVDGHHVVIRGI
EQLSSTSVWSSDIRAGAGLVLAALCADGVTEVHDVFHIDRGYPNFVENLQKLGATIERVS
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtggggcacgtgaaagacaagtttttagtcactggtggagcacagctgcagggcgctgta
aaagtttacggcgcaaaaaacagcgttttgaagctcatggcagcagcacttctcgctgaa
ggcacaacaactctaaccaattgccccgaaatcctcgacgtccccctgatgcgcgacgtc
ctcgttggtcttggctgcgatgtcaccatcgacggctcaaccgtaaccattactacccct
gcagaactcagctccaatgctgacttcccagcagtcacccaattccgtgcatccgtatgt
gtgcttggtccattgacagcacgttgtggtcgcgcagttgtatcccttcccggcggtgac
gccattggatcccgtccactcgacatgcatcaaagcggcctggaaaagcttggtgccacc
acccgcatttcccacggtgcagtagttgcagaagctgaaaagctcgtcggtgccaacatc
accctggatttcccgtccgtcggcgccaccgaaaacatcctcactgcatccgtcatggca
gaaggacgcacagtattagataacgcagcgcgcgaaccagaaattgttgatctctgccgt
atgcttcgatccatgggcgccaacattgaaggtgaaggaagcccaaccatcaccatcgaa
ggcgtagagaaactcaccccaactcagcacgaagtaatcggcgaccgcatcgttgccgga
acgtgggcatacgccgctgcgatgactcgtggcgatattacagttggcggaatcgcacca
aggtatctgcaccttccattggaaaagctcaagatcgccggcgccaaggtggaaacctac
gaaaacggcttccgcgtccaaatggataagcagcctgaggcaaccgactaccaaaccctc
ccgttcccagggttccctacagatctgcaacccatggcaattggaatcaacgcagtatct
aatggaacttcagtaattacagagaatgtctttgaatcacgattccgcttcgtcgatgaa
atgcttcgcctgggcgctgacgcgaatgtcgatgggcaccacgtagtaatccgaggaatt
gaacagctttcctctacttccgtgtggtcttcagatatccgtgcaggagcaggactggtt
cttgccgccctttgcgcagacggagtgaccgaagttcacgatgttttccacatcgaccgc
ggataccccaacttcgtggaaaatctgcagaaactcggagcgaccatcgaaagggtttct
tcctaa

DBGET integrated database retrieval system