KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2837Help
Entry
cg2837            CDS       T00244                                 

Gene name
sucC
Definition
(GenBank) SUCCINYL-COA SYNTHETASE BETA SUBUNIT
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00020  Citrate cycle (TCA cycle)
cgb00640  Propanoate metabolism
cgb00660  C5-Branched dibasic acid metabolism
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01120  Microbial metabolism in diverse environments
cgb01130  Biosynthesis of antibiotics
cgb01200  Carbon metabolism
Module
cgb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cgb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cg2837 (sucC)
   00640 Propanoate metabolism
    cg2837 (sucC)
   00660 C5-Branched dibasic acid metabolism
    cg2837 (sucC)
Enzymes [BR:cgb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     cg2837 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAF21227
UniProt: Q8NMK7
Position
complement(2697052..2698260)
Genome map
AA seq 402 aa AA seqDB search
MELAVDLFEYQARDLFETHGVPVLKGIVASTPEAARKAAEEIGGLTVVKAQVKVGGRGKA
GGVRVAPTSAQAFDAADAILGMDIKGHTVNQVMVAQGADIAEEYYFSILLDRANRSYLAM
CSVEGGMEIEILAKEKPEALAKVEVDPLTGIDEDKAREIVTAAGFETEVAEKVIPVLIKI
WQVYYEEEATLVEVNPLVLTDDGDVIALDGKITLDDNADFRHDNRGALAESAGGLDILEL
KAKKNDLNYVKLDGSVGIIGNGAGLVMSTLDIVAAAGERHGGQRPANFLDIGGGASAESM
AAGLDVILGDSQVRSVFVNVFGGITACDVVAKGIVGALDVLGDQATKPLVVRLDGNNVVE
GRRILAEYNHPLVTVVEGMDAAADHAAHLANLAQHGQFATAN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaattggcagtggatctttttgaataccaagcacgggacctctttgaaacccatggt
gtgccagtgttgaagggaattgtggcatcaacaccagaggcggcgaggaaagcggctgag
gaaatcggcggactgaccgtcgtcaaggctcaggtcaaggtgggcggacgtggcaaggcg
ggtggcgtccgtgtggcaccgacgtcggctcaggcttttgatgctgcggatgcgattctc
ggcatggatatcaaaggacacactgttaatcaggtgatggtggcgcagggcgctgacatt
gctgaggaatactatttctccattttgttggatcgcgcgaatcgttcgtatctggctatg
tgctctgttgaaggtggcatggagatcgagatcctggcgaaggaaaagcctgaagctttg
gcaaaggtggaagtggatcccctcactggtattgatgaggacaaagcgcgggagattgtc
actgctgctggctttgaaactgaggtggcagagaaagtcattccggtgctgatcaagatc
tggcaggtgtattacgaagaggaagcaacactcgttgaggtgaacccgttggtgctcacg
gatgacggcgatgtgattgcgcttgatggcaagatcacgctggatgataacgctgatttc
cgccatgataaccgtggtgcgttggctgaatctgccggtggcttggacattttggaactg
aaggccaagaagaatgatctgaactacgtgaaacttgatggctctgtgggcatcattggc
aatggtgcaggtttggtgatgtccacgttggatatcgtggctgcagctggtgaacgccat
ggtgggcagcgccccgcgaacttcctagacattggtggcggagcatcagctgaatcgatg
gctgctggtctcgatgtgatccttggggatagccaggtacgcagtgtgtttgtgaatgtg
tttggtggcatcaccgcgtgtgatgtggtggcaaagggaatcgttggagctttggatgtg
ctcggcgatcaagcaacgaagcctcttgtggtgcgccttgatggcaacaacgtggtggaa
ggcagacgaatcctcgcggaatataaccaccctttggtcaccgttgtggagggtatggat
gcagcggctgatcacgctgcccatttggccaatcttgcccagcacggccagttcgcaacc
gctaattag

DBGET integrated database retrieval system