KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2982Help
Entry
cg2982            CDS       T00244                                 

Gene name
folP1
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cg2982 (folP1)
Enzymes [BR:cgb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     cg2982 (folP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2839036..2839890)
Genome map
AA seq 284 aa AA seqDB search
MNVSSLTIPGRCLVMGIVNVTEDSFSDGGKYIDVDQAIAHAKELVAAGADMIDVGGESTR
PGAVRVDASVERDRVVPVIKALHDAGIHTSVDTMRASVAQAAAGAGVSMINDVSGGLADP
EMFSVMAEAQIPVCLMHWRTLQFGDAAGQADHGGDVVADVHAVLDDLVARATAAGVAENQ
IVLDPGLGFAKSREDNWRLLQALPEFISGPFPILVGASRKRFLAGVRKDRGLDVTPIDAD
PATAAVTAVSAHMGAWGVRVHDVPVSRDAVDVAALWRSGGTHHG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtatcctctttgaccatcccgggacgctgtttggtcatgggaattgtcaatgtc
actgaggattccttttcggacggtggcaagtacattgacgttgatcaggcgatcgcgcat
gccaaggaattggtggctgctggcgccgacatgattgatgtcggcggcgagtccacccgg
cctggggcagtgcgcgtcgacgcgtccgtggaacgggaccgggttgtgccggtcattaag
gcgcttcacgacgccggcatccacacttccgtagacaccatgcgggcctccgtggcgcag
gctgccgcgggcgctggcgtctccatgatcaacgacgtctctggcggtttggctgatcct
gagatgttttctgtcatggcggaagcgcaaattcccgtgtgtttgatgcactggcgcacc
ctccaattcggtgatgccgcaggtcaggcagatcacggtggagacgttgtagccgatgtg
cacgcagtgcttgatgatcttgtcgcccgcgccaccgctgctggtgtggccgaaaaccag
atcgtgcttgatccaggtttgggttttgccaaatcacgtgaagacaactggcgtttgctg
caagcactgcccgagtttatttctggacctttccccatcctggtgggagcatcccggaag
cgattcctggctggcgtgcgcaaagaccgtggcctagatgtcacccccattgatgccgac
ccagcaaccgcagcggtgaccgcagtgtctgcacatatgggagcatggggtgtgcgcgtg
cacgatgtcccagtatcaagggacgctgttgatgttgccgcattgtggcgaagtggagga
actcaccatggctga

DBGET integrated database retrieval system