KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2982Help
Entry
cg2982            CDS       T00244                                 

Gene name
folP1
Definition
(GenBank) DIHYDROPTEROATE SYNTHASE
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00790  Folate biosynthesis
cgb01100  Metabolic pathways
Module
cgb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cg2982 (folP1)
Enzymes [BR:cgb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     cg2982 (folP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: CAF20717
Position
complement(2839036..2839890)
Genome map
AA seq 284 aa AA seqDB search
MNVSSLTIPGRCLVMGIVNVTEDSFSDGGKYIDVDQAIAHAKELVAAGADMIDVGGESTR
PGAVRVDASVERDRVVPVIKALHDAGIHTSVDTMRASVAQAAAGAGVSMINDVSGGLADP
EMFSVMAEAQIPVCLMHWRTLQFGDAAGQADHGGDVVADVHAVLDDLVARATAAGVAENQ
IVLDPGLGFAKSREDNWRLLQALPEFISGPFPILVGASRKRFLAGVRKDRGLDVTPIDAD
PATAAVTAVSAHMGAWGVRVHDVPVSRDAVDVAALWRSGGTHHG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtatcctctttgaccatcccgggacgctgtttggtcatgggaattgtcaatgtc
actgaggattccttttcggacggtggcaagtacattgacgttgatcaggcgatcgcgcat
gccaaggaattggtggctgctggcgccgacatgattgatgtcggcggcgagtccacccgg
cctggggcagtgcgcgtcgacgcgtccgtggaacgggaccgggttgtgccggtcattaag
gcgcttcacgacgccggcatccacacttccgtagacaccatgcgggcctccgtggcgcag
gctgccgcgggcgctggcgtctccatgatcaacgacgtctctggcggtttggctgatcct
gagatgttttctgtcatggcggaagcgcaaattcccgtgtgtttgatgcactggcgcacc
ctccaattcggtgatgccgcaggtcaggcagatcacggtggagacgttgtagccgatgtg
cacgcagtgcttgatgatcttgtcgcccgcgccaccgctgctggtgtggccgaaaaccag
atcgtgcttgatccaggtttgggttttgccaaatcacgtgaagacaactggcgtttgctg
caagcactgcccgagtttatttctggacctttccccatcctggtgggagcatcccggaag
cgattcctggctggcgtgcgcaaagaccgtggcctagatgtcacccccattgatgccgac
ccagcaaccgcagcggtgaccgcagtgtctgcacatatgggagcatggggtgtgcgcgtg
cacgatgtcccagtatcaagggacgctgttgatgttgccgcattgtggcgaagtggagga
actcaccatggctga

DBGET integrated database retrieval system