KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2983Help
Entry
cg2983            CDS       T00244                                 

Gene name
folE
Definition
(GenBank) GTP CYCLOHYDROLASE
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00790  Folate biosynthesis
cgb01100  Metabolic pathways
Module
cgb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cg2983 (folE)
Enzymes [BR:cgb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     cg2983 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CAF20718
UniProt: Q8NM84
Position
complement(2839891..2840496)
Genome map
AA seq 201 aa AA seqDB search
MKETTVDNHAAVREFDEERATAAIRELLIAVGEDPDREGLLETPARVARAYKETFAGLHE
DPTTVLEKTFSEGHEELVLVREIPIYSMCEHHLVPFFGVAHIGYIPGKSGKVTGLSKLAR
LADMFAKRPQVQERLTSQIADALVEKLDAQAVAVVIEAEHLCMAMRGIRKPGAVTTTSAV
RGGFKNNAASRAEVFSLIRGH
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagacaaccgtggataaccacgctgcagttcgcgagttcgatgaggagcgcgca
acagctgcgattcgtgagttgctcatcgctgtgggtgaggatccagatcgcgaaggcctg
ttggaaaccccagctcgagtggctagggcgtacaaggaaactttcgcgggtctgcatgag
gatcccaccactgtgctggagaagacgttctctgagggccatgaagagttggttctggtt
cgtgagatcccgatttactccatgtgtgagcaccacttggtgccgttctttggcgtggcg
cacattggttacattccgggtaagtccggcaaggtgactggcctgtccaagctggcgcgt
ttagcggatatgtttgctaagcgacctcaggttcaggagcgcttgacctcccaaattgcg
gatgctctcgtcgaaaagcttgatgcccaggccgtggccgtggtgattgaagctgagcac
ctgtgcatggccatgcgcggaatccgtaagcctggtgctgtgaccacgacgtctgcggtg
cgcggcggttttaagaacaacgctgcctcccgcgctgaggtgttctccctgattcggggg
cactaa

DBGET integrated database retrieval system