KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2983Help
Entry
cg2983            CDS       T00244                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cg2983 (folE)
Enzymes [BR:cgb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     cg2983 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2839891..2840496)
Genome map
AA seq 201 aa AA seqDB search
MKETTVDNHAAVREFDEERATAAIRELLIAVGEDPDREGLLETPARVARAYKETFAGLHE
DPTTVLEKTFSEGHEELVLVREIPIYSMCEHHLVPFFGVAHIGYIPGKSGKVTGLSKLAR
LADMFAKRPQVQERLTSQIADALVEKLDAQAVAVVIEAEHLCMAMRGIRKPGAVTTTSAV
RGGFKNNAASRAEVFSLIRGH
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagacaaccgtggataaccacgctgcagttcgcgagttcgatgaggagcgcgca
acagctgcgattcgtgagttgctcatcgctgtgggtgaggatccagatcgcgaaggcctg
ttggaaaccccagctcgagtggctagggcgtacaaggaaactttcgcgggtctgcatgag
gatcccaccactgtgctggagaagacgttctctgagggccatgaagagttggttctggtt
cgtgagatcccgatttactccatgtgtgagcaccacttggtgccgttctttggcgtggcg
cacattggttacattccgggtaagtccggcaaggtgactggcctgtccaagctggcgcgt
ttagcggatatgtttgctaagcgacctcaggttcaggagcgcttgacctcccaaattgcg
gatgctctcgtcgaaaagcttgatgcccaggccgtggccgtggtgattgaagctgagcac
ctgtgcatggccatgcgcggaatccgtaagcctggtgctgtgaccacgacgtctgcggtg
cgcggcggttttaagaacaacgctgcctcccgcgctgaggtgttctccctgattcggggg
cactaa

DBGET integrated database retrieval system