KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg3107Help
Entry
cg3107            CDS       T00244                                 

Gene name
adhA
Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    cg3107 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cg3107 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    cg3107 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    cg3107 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    cg3107 (adhA)
   00626 Naphthalene degradation
    cg3107 (adhA)
Enzymes [BR:cgb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     cg3107 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2969050..2970087)
Genome map
AA seq 345 aa AA seqDB search
MTTAAPQEFTAAVVEKFGHDVTVKDIDLPKPGPHQALVKVLTSGICHTDLHALEGDWPVK
PEPPFVPGHEGVGEVVELGPGEHDVKVGDIVGNAWLWSACGTCEYCITGRETQCNEAEYG
GYTQNGSFGQYMLVDTRYAARIPDGVDYLEAAPILCAGVTVYKALKVSETRPGQFMVISG
VGGLGHIAVQYAAAMGMRVIAVDIADDKLELARKHGAEFTVNARNEDSGEAVQKYTNGGA
HGVLVTAVHEAAFGQALDMARRAGTIVFNGLPPGEFPASVFNIVFKGLTIRGSLVGTRQD
LAEALDFFARGLIKPTVSECSLDEVNGVLDRMRNGKIDGRVAIRF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgctgcaccccaagaatttaccgctgctgttgttgaaaaattcggtcatgac
gtgaccgtgaaggatattgaccttccaaagccagggccacaccaggcattggtgaaggta
ctcacctccggcatctgccacaccgacctccacgccttggagggcgattggccagtaaag
ccggaaccaccattcgtaccaggacacgaaggtgtaggtgaagttgttgagctcggacca
ggtgaacacgatgtgaaggtcggcgatattgtcggcaatgcgtggctctggtcagcgtgt
ggcacctgcgaatactgcatcaccggcagggaaactcagtgcaacgaagctgagtatggt
ggctacacccaaaatggatccttcggccagtacatgctggtggatacccgttacgccgct
cgcatcccagacggcgtggactacctcgaagcagcaccaattctgtgtgcaggcgtgact
gtctacaaggcactcaaagtctctgaaacccgcccgggccaattcatggtgatctccggt
gtcggcggacttggccacatcgcagtccaatacgcagcggcgatgggcatgcgtgtcatt
gcggtagatattgccgatgacaagctggaacttgcccgtaagcacggtgcggaatttacc
gtgaatgcgcgtaatgaagattcaggcgaagctgtacagaagtacaccaacggtggcgca
cacggcgtgcttgtgactgcagttcacgaggcagcattcggccaggcactggatatggct
cgacgtgcaggaacaattgtgttcaacggtctgccaccgggagagttcccagcatccgtg
ttcaacatcgtattcaagggcctgaccatccgtggatccctcgtgggaacccgccaagac
ttggccgaagcgctcgatttctttgcacgcggactaatcaagccaaccgtgagtgagtgc
tccctcgatgaggtcaatggtgtgcttgaccgcatgcgaaacggcaagatcgatggtcgt
gtggcgattcgtttctaa

DBGET integrated database retrieval system