KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg3158Help
Entry
cg3158            CDS       T00244                                 

Gene name
nagA2
Definition
Beta-N-acetylglucosaminidase precursor (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cgb00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cgb00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3014051..3015208)
Genome map
AA seq 385 aa AA seqDB search
MWKRLKPLAAAVAVAGVLLAGCAEEPEQQKAISRLSTSPSTPPAPTAEDLARAQIPEQQR
DQVASLMMVGVANYDQALDALNQGVGGIFIGSWTDENLLTEPGRNIEALREAVGRDFSVS
IDFEGGRVQRATNILGDFPSPRVMAQTMTPEQVEDLAEILGTGLAAHGVTVNFAPVVDVD
AWGLPVVGDRSFSNDPAVAATYATAFAKGLSKVGITPVFKHFPGHGRASGDSHTQDVVTP
ALDELKTYDLIPYGQALSETDGAVMVGHMIVPGLGTDGVPSSIDPATYQLLRSGDYPGGV
PFDGVIYTDDLSGMSAISATHSPAEAVLASLKAGADQALWIDYGSLGSAIDRVDAAVSSG
EYPQEQMLASALRVQLLYITRLEQK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgtggaagcgattgaaacccctcgcagcagccgtcgcggtagccggtgtgctccttgcg
ggctgcgcagaagagccggaacagcaaaaagcaataagccgcttatcgacgtccccctcc
acccctcccgcaccgaccgcggaggatttggcgcgcgcgcaaatccctgaacagcaacgc
gaccaagtcgcgtcgctgatgatggttggagttgcgaattatgatcaggcattggatgcg
ctcaatcagggggtgggtggcatctttattggttcctggacagatgaaaatctgctcacg
gaacctggccgtaatattgaggcgctccgcgaagccgtcggcagggatttctccgtcagc
atcgacttcgaaggcggccgcgtccagcgtgccaccaatattcttggtgatttcccctca
ccgcgcgtgatggcgcaaaccatgacgccggaacaagtagaagatctcgcagaaatccta
ggcactggtttagctgcacatggtgtgacagttaactttgcacctgttgtagatgtagat
gcttggggtctccccgtcgttggcgatcgttccttttccaacgacccagccgtagcagct
acttatgccacagcttttgcaaagggcttaagcaaagtaggaattaccccagtattcaaa
catttcccaggtcacggtcgtgcaagtggcgattcgcacacccaagatgtggtgaccccc
gcacttgatgagcttaaaacttacgacctcatcccttatggtcaagcactttctgaaact
gacggagccgtcatggtgggccacatgattgttccaggtcttggcaccgacggagttcca
tcctctatcgaccccgccacctatcaactgctccgcagtggcgattacccaggtggcgtg
cctttcgatggcgtgatctacaccgacgatctctctggaatgagtgccatttccgccacc
cattcacccgcagaagcagtgcttgcctccctcaaagcaggcgcagaccaagcactatgg
atcgactatgggtcgttgggctccgcgattgatcgcgttgatgctgccgttagcagcggt
gaataccctcaagaacaaatgctggcatctgcgttaagagtccaattgctctacatcaca
cgtctcgaacaaaagtga

DBGET integrated database retrieval system