KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg3328Help
Entry
cg3328            CDS       T00244                                 

Gene name
mutM2
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cgb03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3175213..3176022
Genome map
AA seq 269 aa AA seqDB search
MPEGHVIHRLAGELTKNFGDTILDATSPQGRFTSEAAIINGHRIAVAEAYGKHLFVEFDA
DHPEHILYIHLGLIGTLQFEPAEETRGQIRLHLSDGEIAANLRGPQWCRLITDAERTQAI
GKLGADPIRDDADPEPIRIKVQRSGRSIGSLLMDQKLFAGVGNIYRAETLFRLGISPFTI
GKDITTAQFRSIWADLVGLMKDGVVTGRIDTVRPEHTPEAMGRPPRKDDHGGEVYTYRRT
GQECFLCATPIKEQVMEGRNLFWCPGCQR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaggacacgtgattcatcgactagctggggaactcaccaagaattttggcgat
accattttggacgccacttcacctcaaggacgctttacttctgaagcggcgatcatcaac
ggtcaccgcatcgcggttgcggaggcttacggcaagcacctgttcgtcgagttcgatgcg
gatcaccctgagcacattttgtatatccatttggggctgattggcacgttgcagtttgaa
cctgcggaagaaacccgcgggcagattcgcctgcacctttccgacggggagatcgcagct
aatttgcgcggaccccaatggtgcaggttgatcaccgatgcagagcgcacccaggccatt
ggaaaattgggcgctgatccgattcgcgatgatgccgatccggaaccaattcggattaag
gtgcagcgctcagggcgaagcattggttcgttgttgatggatcagaagcttttcgcaggt
gtgggaaatatctaccgtgcggagacacttttccgcctggggatttcaccgttcaccatt
ggaaaagacatcaccacggcacagttccgatccatttgggcggatcttgttgggttgatg
aaagacggtgttgtgactggtcggattgatactgtgcgcccggaacacacaccggaggcg
atgggtaggccaccgcggaaagatgatcacggcggtgaggtttacacctatcggcgaacc
ggtcaagagtgctttctgtgcgcaactcccatcaaggagcaggtcatggagggtcgcaac
ttattttggtgtcccggctgccaacgctag

DBGET integrated database retrieval system