KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg3364Help
Entry
cg3364            CDS       T00244                                 

Gene name
trpA
Definition
(GenBank) TRYPTOPHAN SYNTHASE ALPHA CHAIN
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Pathway
cgb00260  Glycine, serine and threonine metabolism
cgb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cgb01100  Metabolic pathways
cgb01110  Biosynthesis of secondary metabolites
cgb01130  Biosynthesis of antibiotics
cgb01230  Biosynthesis of amino acids
Module
cgb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cgb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cg3364 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cg3364 (trpA)
Enzymes [BR:cgb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cg3364 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA IMPDH His_biosynth NMO FMN_dh Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: CAF18975
UniProt: P06562
Position
3212640..3213482
Genome map
AA seq 280 aa AA seqDB search
MSRYDDLFARLDTAGEGAFVPFIMLSDPSPEEAFQIISTAIEAGADALELGVPFSDPVAD
GPTVAESHLRALDGGATVDSALEQIKRVRAAYPEVPIGMLIYGNVPFTRGLDRFYQEFAE
AGADSILLPDVPVREGAPFSAAAAAAGIDPIYIAPANASEKTLEGVSAASKGYIYAISRD
GVTGTERESSTDGLSAVVDNIKKFDGAPILLGFGISSPQHVADAIAAGASGAITGSAITK
IIASHCEGEHPNPSTIRDMDGLKKDLTEFISAMKAATKKV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttacgacgatctttttgcacgcctcgacacggcaggggagggcgcctttgtt
cccttcatcatgctgagcgacccttcaccagaggaggctttccagatcatctccacagca
atcgaagctggcgcagatgcactggaacttggcgtacctttctccgacccagttgccgat
ggccccaccgtcgcggaatcccacctccgcgcactcgacggcggcgccaccgtagacagc
gcactcgagcagatcaagcgcgtgcgcgcagcctacccagaggttcccatcggaatgctc
atctacggcaacgttcctttcacccgtggcttggatcgcttctaccaagagttcgctgaa
gctggcgcagactccatcctcctgccagacgtcccagtccgcgaaggcgcaccgttttct
gcagcagctgcagcagccggaattgatcccatttacatcgctccggccaacgccagcgag
aaaaccctcgagggtgtctccgccgcatcaaagggctacatctacgccatctcccgcgac
ggcgtcaccggcaccgaacgtgaatcatccaccgacggcctgtccgcagtggtggacaac
atcaagaaatttgatggcgcacccatcctcttgggcttcggcatctcatcccctcagcac
gtggcagacgcgattgcagcgggtgcttccggtgcgatcacgggttccgcgatcaccaag
atcattgcttcccactgcgaaggtgagcacccgaacccgtccaccattcgagatatggac
ggtttgaagaaggatctcactgagttcatctctgcgatgaaggcagcgaccaagaaggtt
tag

DBGET integrated database retrieval system