KEGG   Cyanobium gracile: Cyagr_0035Help
Entry
Cyagr_0035        CDS       T02359                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cgc  Cyanobium gracile
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cgc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(31283..32026)
Genome map
AA seq 247 aa AA seqDB search
MTSTLPTGLSARQAAPVTTPIPVSLRIRERLQKEGIPFLANDNISDHLREGELDQLEIEV
AGKVRDLLRSLVIDIENDHNTEETAERVAKMYLHEVFKGRYHEQPKIASFPNVKQLDEIY
TVGPISIRSACSHHLVPILGNCWIGIKPGERVIGLSKFSRVADWVFSRPHIQEEAVIILA
NEIERLCQPLGLAILVKAQHYCMKWRGVKEPQTSMVNSVVRGDFRHDPSLKQEFFELVRQ
QEALLST
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacatccaccctccccactggcctaagcgcccgtcaggccgctcccgtcacgaccccc
atccccgtcagcctgcggatccgcgaacggctgcagaaggaagggatcccgtttctggcc
aacgacaacatctccgaccacctgcgcgagggtgagctcgaccagctggagatcgaggtg
gccggcaaggtgcgcgacctgctgcgcagcctggtgatcgatatcgagaacgaccacaac
accgaggagacggccgagcgggtcgccaagatgtacctccacgaggtgttcaagggtcgt
taccacgagcagccgaagatcgccagcttccccaacgtgaagcagctcgatgagatctac
accgtcgggcccatctccatccgttccgcctgttcccaccacctggttccgatcctcggc
aactgctggatcggcatcaaacccggtgagcgggtgatcggcctgtcgaagttctctcgc
gtcgccgactgggtcttctcccggccccacatccaggaggaggcggtgatcatcctcgcc
aacgagatcgagcggctctgccagcccctcggactggcgatcctggttaaggcccagcac
tactgcatgaaatggcgcggggtgaaggaaccccagaccagcatggtcaactcggtcgtg
cgcggtgatttccgccacgacccgagcctcaagcaggagttcttcgagctcgtgcgtcag
caggaggccctgctcagcacctga

DBGET integrated database retrieval system