KEGG   Cyanobium gracile: Cyagr_0114Help
Entry
Cyagr_0114        CDS       T02359                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cgc  Cyanobium gracile
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyagr_0114
Enzymes [BR:cgc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cyagr_0114
Exosome [BR:cgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyagr_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(105123..107417)
Genome map
AA seq 764 aa AA seqDB search
MALPSLEWMVEDARRLAECRHDHPFSVLGPQPLEDGGWAVRVWMPDAHTVELLQGGERLA
MANPHHPWIFEARLEADPGCGYRVQVSRGGIEHEQHDPWAFRHEWMGELDRHLFAEGNHH
HIWRRMGAHVIERDGVAGVQFCLWAPNARSVALLGDFNGWDGRHHPMQQRLGGIWELFIP
GLGVGQIYKYEVRAQNGHCYQKADPYGFRHEIRPNTGSVVAELGRYPWNDGAWIEERDGR
DPLPQPIAVYEMHLGSWMHAAADQPFIEADGRPRPPVPAADLKPGARLMTYPELADKVIP
YVKARGFTHIELMPVSEHPFDGSWGYQVTGWYAPTSRFGSPDEFRAFVDRCHAEGIGVIL
DWVPGHFPKDGHGLAFFDGAHLYEHADPRIGEHKEWGTLIFNYSRNEVRNFLVANLIYWF
EEFHIDGIRVDAVASMLYRDYLRPDGEWLPNEHGGRENLEAVRFLQQANHVLFQHFPGAL
SIAEESTTWPMVTQPTDMGGLGFNLKWNMGWMHDMLDYFELDPWFRQFHQNHVTFSIWYA
FTENFMLALSHDEVVHGKSNLLHKMPGDDWQKFANVRALLAYMWTHPGKKTIFMGMEFGQ
RAEWNVWGDLQWELLQYEAHKGLLNLVDDLNVFYRSEPALWGDDFDPYGFQWIDCNDNRH
SVISFMRRDSGSGRWVVVVANFTPQSHSHYRVGVPLEGFYAEVFNTDSSRYGGSNLGNLG
GRFTDAWAIHDYENSLELCLPPLGVVVFRLDESRSLQRPAIGEG
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggccctgcccagcctcgaatggatggttgaggatgcccgccggctggcggaatgccgc
cacgaccatcccttctccgtgctcgggccccagccccttgaagacggtggctgggcggtg
cgggtctggatgccggacgcccacacggtggagctgcttcagggcggtgagcggctggcc
atggccaacccacaccatccctggatcttcgaagcccgccttgaggccgatcccggctgc
ggctaccgcgtgcaagtgagccgcggcggcatcgagcacgagcagcacgacccctgggcg
ttccggcacgagtggatgggggagctggaccgccacctgttcgccgaagggaatcaccac
cacatctggcggcgcatgggcgcccatgtcatcgagcgcgacggcgtcgccggggtgcag
ttctgcctgtgggcccccaatgcccgcagcgtcgccctgctgggtgatttcaacggctgg
gacggccgccatcaccccatgcagcagcgtctcggggggatctgggagctgttcatcccc
ggcctgggcgtcggccagatctacaagtacgaggtgcgggcccagaacggccactgctat
cagaaggccgacccctacggcttccgccacgagatccggccgaacaccggttcggtggtg
gccgaactgggccgctacccgtggaacgacggtgcctggatcgaggagcgggacggccgc
gatcccctgccccagccgatcgcggtgtacgagatgcacctgggcagctggatgcatgcc
gccgccgaccagcccttcatcgaagccgacggccgcccccggccgccggtgcccgccgcc
gatctgaagcccggcgcccggctgatgacctacccggaactggccgacaaggtcattccc
tatgtcaaggcccgcggcttcacccacatcgagctgatgccggtctccgagcatccgttc
gacggctcctgggggtatcaggtcaccggctggtacgcccccaccagccgcttcggcagc
cccgacgagttccgggccttcgtcgaccgctgccacgccgaaggcatcggcgtgatcctc
gactgggtgcccggccacttccccaaggacggccacggcctggccttcttcgatggcgcc
cacctctacgagcatgccgacccccgcatcggtgagcacaaggagtggggcacgctgatc
ttcaactacagccgcaacgaggtgcgcaacttcctcgtcgccaacctcatctactggttc
gaggagttccacatcgacggcatccgtgtcgatgccgtggcctcgatgctctaccgcgac
tacctgcgtccggatggggaatggctgcccaacgagcacggcggacgggagaatctggag
gcggtgcgcttcttgcagcaggccaaccacgtgctgttccagcacttccccggcgccctc
tcgatcgccgaggaatcgaccacctggccgatggtgacccagcccaccgacatgggcggc
ctgggcttcaacctcaagtggaacatgggctggatgcacgacatgctcgattacttcgag
ctggatccctggttccgccagttccaccagaaccacgtcaccttctcgatctggtacgcc
ttcaccgagaacttcatgctggccctgagccacgatgaagtggtgcacggcaagagcaac
ctgctccacaagatgccgggcgacgactggcagaagttcgccaacgtgcgcgccctgctg
gcctacatgtggacgcacccgggcaagaagacgatcttcatggggatggagttcggccag
cgggccgaatggaacgtctggggtgatctgcagtgggagctgctccagtacgaggcccac
aagggactgctcaacctggtggacgacctcaacgtcttctacagatcggagccggcgctg
tggggcgacgacttcgatccgtacggcttccagtggatcgactgcaacgacaaccgccac
tcggtgatcagcttcatgcgccgcgacagcggcagcggccgctgggtggtggtggtggcc
aacttcacgccccagagccattcccactatcgggtgggtgtgccgctggagggcttctac
gccgaggtcttcaacaccgacagcagccgctacggcggcagcaacctcggcaacctgggc
ggtcgcttcaccgatgcctgggccatccacgactacgagaactccctggagctctgcctg
ccgcctctgggcgtggtggtgttccgtctcgacgagtcccgcagcctgcagcgtccggcc
atcggcgagggctga

DBGET integrated database retrieval system