KEGG   Cyanobium gracile: Cyagr_0133Help
Entry
Cyagr_0133        CDS       T02359                                 

Definition
transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cgc  Cyanobium gracile
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyagr_0133
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyagr_0133
   00052 Galactose metabolism
    Cyagr_0133
   00500 Starch and sucrose metabolism
    Cyagr_0133
   00520 Amino sugar and nucleotide sugar metabolism
    Cyagr_0133
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cyagr_0133
   00524 Butirosin and neomycin biosynthesis
    Cyagr_0133
Enzymes [BR:cgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cyagr_0133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
130334..131248
Genome map
AA seq 304 aa AA seqDB search
MASSPARPPGEAQLIGIDLGGTAIKLARCDPQGTVLAEAEVPTPRPAVPGAVCMALAEAV
EAIDPDRLADRVGIGLPGPCDTAGRVARISINLPGWRDVPLAAWLEARLERRVILGNDAN
GALLGEAWLGAARGAGDVLLLTLGTGVGGAVLLEGRLFTGHGGAAAEPGLIGVDPDGPPC
RSGNRGSLEQFCSIGGLARLSPLDPRELCRRADAGDTEALAVWQAYGRPLGVGLSSLLYV
LTPELVLIGGGLSAASHHFLPAVWREVEERVLAVSREGLVIRRCALGNGAGRLGAVRLAL
DRLG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcccccgcacgacctcccggtgaggcccagctgatcggcatcgatctgggg
ggcacggccatcaagctggcccgctgcgacccgcagggcaccgtgctcgccgaggccgag
gtgcccacgccccggcccgcagtgccgggggcggtctgcatggccctggccgaggcggtc
gaggcgatcgaccccgaccgcctcgccgaccgggtgggcatcggcctgccggggccctgc
gacacggccggccgggtggcgcggatctccatcaacctgccggggtggcgggatgtgccc
ctggccgcctggctcgaagcccggctggagcggcgggtgatcctgggcaacgatgccaac
ggcgccctgctcggtgaggcctggctgggggcggcccggggcgcaggcgacgtgctgctg
ctcaccctgggcaccggtgtgggcggggcggtgctgctggagggccggctgttcaccggc
cacggcggcgcggcggccgaaccgggcctgatcggtgtcgaccccgatggcccgccgtgc
cgcagcggcaaccggggctccctggagcagttctgcagcatcggcggcctggcccgcctc
agcccgctcgatccacgcgagctctgccgccgcgccgacgccggcgacacggaggccctg
gcggtgtggcaggcctacggacgccccctcggtgtggggctgagctcattgctctatgtg
ctcactccggagctggtgctgatcggcgggggcctcagcgccgccagccaccacttcctg
ccggcggtctggcgggaggtggaggagcgggtgctggcggtgagccgggagggattggtg
atccgtcgctgcgccctcggcaacggtgccggccggctgggggcggtgcggctggcgctg
gaccgcttgggatga

DBGET integrated database retrieval system