KEGG   Cyanobium gracile: Cyagr_0204Help
Entry
Cyagr_0204        CDS       T02359                                 

Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cgc  Cyanobium gracile
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cgc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(195874..196905)
Genome map
AA seq 343 aa AA seqDB search
MAQALPILYSFRRCPFAIRARLVLASAGLRPGVDLELREVHLGRKPPELLEASAAATVPT
LVLPPDAASTPPVAARVLPDSLAVMAWALERHDPGDLGRQGGSEAAGRDRGRIAALIAEN
DGAFKHHLDRFKYAHRHPEDDREQQRGAALAILRGWSATLEAGGWLVGGRPSLADVALLP
FVRQFRLADPEGFDRQADLAPLQDWLQRFLQGADLAAVMAEPWAPRRPWRSDGWIYHLAL
GGEWRDAKARGVYERSTRGQTLQEVGFIHASGSHQVEATYGRFYADAEEVLLLTIDPRRL
SAPLLWEPAPNSGECFPHIHGPLPLEAVLAAEPFPPPLAGARC
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggccctgcccatcctctacagcttccgtcgctgccccttcgcgatccgggcg
cggctggtcctggcgtcggccgggctgaggccgggggtggatctcgagctgcgggaggtg
catctgggccgcaagccccccgagttgctggaggcctccgccgccgccaccgtgccgacc
ctggtgctgccaccggacgcggcctccacccccccggtggctgcccgggtgctgccggac
agcctggcggtgatggcctgggccctggagcgccacgaccccggcgacctggggcgccag
gggggcagcgaagccgctgggcgggaccgtggccggatcgccgccctgatcgctgagaac
gacggggcgttcaagcaccatctggatcgcttcaagtacgcccaccgccatcccgaggac
gaccgggagcagcagcgcggggcggcgctggccatcctgcggggctggagcgcgaccctg
gaggccggcggctggctggtgggggggcggccgtccctggccgatgtagccctgctgccc
ttcgtgcgccagttccggcttgccgatccggaggggttcgaccgacaggcggatctggcg
ccgctgcaggactggctgcagcgcttcctgcagggggccgatctggccgcggtgatggcc
gagccctgggcgccacggcggccctggcgctccgacggttggatctatcacctggccctg
ggcggcgagtggcgggatgccaaagcccgcggcgtgtacgagcgctcgacccgcggccag
acgctgcaggaggtgggcttcatccatgccagcggttcccaccaggtggaggccacctac
gggcgcttctacgccgatgcggaggaggtgctgctgctgaccatcgacccccggcgcctg
agcgcgccactgctctgggagccggcaccaaacagcggcgaatgcttcccccacatccac
ggaccgctgcccctggaggcggtgctggccgccgagcccttcccgccgccgctggctggc
gcacgatgctga

DBGET integrated database retrieval system