KEGG   Cyanobium gracile: Cyagr_0230Help
Entry
Cyagr_0230        CDS       T02359                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cgc  Cyanobium gracile
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyagr_0230
Enzymes [BR:cgc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cyagr_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(222311..223864)
Genome map
AA seq 517 aa AA seqDB search
MSGDPRACGVLLHPTALPGTPACGSFGAAARDWIDLLAAEGVGVWQLLPLSPTDGTGSPY
SSPSGSALNPWLIDADDLVADGLIPPADRDALPTGPEDHLDPAAAAARAAAIATALARGW
AGQPPERRAAFDRWEERQRFWLVDHCRFMVIRRLQDGRPWWEWPEPLARRQPAALRALVD
ARSQTLQEEALLQWQLQVQWGRLQERAHRQGVRLVGDLPFYVAHDSADVWSHRRLFSLRA
GGGLVEQSGVPPDYFSATGQLWGTPVYRWWVHRLTGFRWWLQRLGRQLELMDLLRLDHFR
ALEAYWSVPGSDATAEHGSWRPSPGAALLGRLRSRCRRQGRLLPGDRLPLIAEDLGVITP
AVEALRDRFALPGMKILQFAFDGNDDNPYLPANYTGSRWVVYTGTHDNATSLGWWRDLDD
GARGRVAAVVGAEVRAPSWQLLEVALASPADLAVVPLQDLLELGDEARFNTPGTIDGNWS
WRLSQPVSALAGPLQGFGAMAARYGRGRGGAAAAGGG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgacccccgcgcctgcggcgtgctgctccaccccaccgccctgccgggcact
ccggcctgtggcagcttcggggccgccgcccgcgactggatcgacctgctggccgccgag
ggggtgggggtgtggcagctgctgcccctgtcccccaccgacggcaccggctccccctac
agctcccccagcggctcggccctcaacccctggctgatcgatgccgacgacctggtggcc
gacggcctgatcccccccgccgaccgtgacgccctgcccaccggacccgaggatcacctc
gatccggcagccgccgctgcgcgggcggccgccatcgccacggccctggcccggggctgg
gccgggcagccgccggagcggcgggcggccttcgatcgctgggaggagcgccagcgtttc
tggctggtcgaccactgccgcttcatggtgatccgccgcctccaggacggccggccctgg
tgggagtggcccgaacccctggcccggcgccagcccgccgccctgcgggccctggtcgac
gcccggagccagaccctgcaggaggaggccctgctgcagtggcagctccaggtccagtgg
ggccggctgcaggagcgggcccatcgccagggggtgcgcctggtgggggacctgcccttc
tacgtggcccacgacagcgccgacgtctggagccaccggcgcctgttctccctgcgggcc
ggcggcgggctggtggagcagagcggcgtgccgccggactacttctccgccaccggccag
ctctggggcaccccggtctaccgctggtgggtgcaccgcctcaccggcttccgctggtgg
ctgcagcggctggggcggcagctggagctgatggacctgctgcggctcgaccacttccgg
gccctggaggcctactggagcgtgcccggctccgatgccaccgccgagcacggctcctgg
cgtccctcccccggcgccgccctgctgggccgcctgcgctcgcgctgccgccgccagggt
cgactgctccccggcgaccggctgccgctgatcgccgaagatctcggcgtcatcaccccg
gcggtggaggccctgcgggaccgcttcgccctgccgggcatgaagatcctgcagttcgcc
ttcgacggcaacgacgacaacccctacctgccggcgaactacaccggcagccgctgggtg
gtgtacaccggcacccacgacaacgccaccagcctcggctggtggcgggacctcgacgac
ggggcccggggacgggtcgcggcggtggtgggggctgaggtgcgggcgccgagctggcag
ctgctggaggtggcgctggcctcgccggccgatctggcggtggtgcccctgcaggacctg
ctggagctgggcgacgaggcccgcttcaacacccccggtaccatcgacggcaactggagc
tggcggctctcgcagccggtgtccgccctggcgggccccctgcagggcttcggcgccatg
gcggcccgctacggccgggggcgcgggggggcggccgcagccgggggcgggtag

DBGET integrated database retrieval system