KEGG   Cyanobium gracile: Cyagr_0461Help
Entry
Cyagr_0461        CDS       T02359                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cgc  Cyanobium gracile
Pathway
cgc00900  Terpenoid backbone biosynthesis
cgc01100  Metabolic pathways
cgc01110  Biosynthesis of secondary metabolites
cgc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cyagr_0461
Enzymes [BR:cgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Cyagr_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFY27653
UniProt: K9P3T4
Position
475876..476826
Genome map
AA seq 316 aa AA seqDB search
MADVTVRAPAKINLHLEVLGLRPDGYHELAMVMQSIDLADTMVLRTTADDTIRLRSDSRE
LPSDGTNLIVRAAELLRSRVGLPELGVDITLHKRIPIGAGLAGGSSDGAAALAGLDALWG
LALGRERLHGLAAELGSDMPFCLEGGTQLCFGRGERLEPVPAAGAPGQALLLIKHPQASV
STPWAYGRCRDLRGDFYLDAEEDFEQRRQALRQGPLVAALAGRGPLPHLRNDLQAVVEPE
VESIRAGLELLRSGPGALAVAMSGSGPSLFALHPDLATAEAAREALAEPLEALGFDTWCC
RCGGSGVSLVTDGSAP
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcagatgtgacggtgcgggcccccgccaagatcaacctgcacctggaggtgctgggt
ctacggccggacggctaccacgagctggcgatggtgatgcagagcatcgacctggccgac
acgatggtgctgcgcaccaccgccgacgacacgatccggctgcgcagcgacagccgcgag
ctgcccagcgacggcaccaacctgatcgtcagggcggccgagctgctgcgctcccgggtg
ggcctgccggaactgggggtggacatcacgctgcacaagcgcatccccatcggcgccggc
ctggcagggggctcgagcgatggggccgccgccctggcaggcctcgacgccctctggggc
ctggccctgggccgcgagcggctgcatggcctggcggccgagctgggatcggacatgccc
ttctgcctggagggcggcacccagctctgcttcggccgcggggagcggctcgagcccgtc
ccggcggcaggggcgcccggccaggcgctgctgctgatcaagcatccccaggccagcgtc
tccaccccctgggcctacggccgctgccgggacctgcggggcgatttctacctcgacgcc
gaggaggacttcgaacagcggcgccaggccctgcgtcagggccccctggtggcggccctg
gccggccggggcccgctgccccacctgcgcaatgacctgcaggcggtggtggagccggag
gtggagagcatccgcgctggcctcgagctgctgcgcagtggcccgggggccctggccgtc
gcgatgagcggctcggggccgagtctgttcgcgctgcacccggatctggccacggcggag
gcggcccgggaggccctggcggagccgctggaggccctgggcttcgacacctggtgctgc
cgctgcggcggatccggtgtcagcctggtgacggatggatccgcaccatga

DBGET integrated database retrieval system