KEGG   Cyanobium gracile: Cyagr_0723Help
Entry
Cyagr_0723        CDS       T02359                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cgc  Cyanobium gracile
Pathway
cgc00260  Glycine, serine and threonine metabolism
cgc00750  Vitamin B6 metabolism
cgc01100  Metabolic pathways
cgc01110  Biosynthesis of secondary metabolites
cgc01120  Microbial metabolism in diverse environments
cgc01230  Biosynthesis of amino acids
Module
cgc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyagr_0723
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cyagr_0723
Enzymes [BR:cgc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cyagr_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFY27911
UniProt: K9P5E0
Position
complement(745780..747132)
Genome map
AA seq 450 aa AA seqDB search
MPEVGFIGGLRTPLLACPPVIGIPLTATLSRSTFTGLRCKECGHPYEAGARHVCEDVCFG
PLEVVYDYDAIRSRVSRATIEAGPTSIWRYREFLPIEGDPIDVGTGFTPLLKADRLARRL
GLSSLYIKNDGVNMPTLSFKDRVVSVALTRARELGFTTVSCASTGNLANSTAAIAAHAGL
ECCVFIPSDLELGKVLGTLVYNPTLMAVKGNYDQVNRLCSEVANTYGWGFVNINLRPYYS
EGSKTLGYEVIEQLGWQLPDHIVAPLASGSLFTKIRKGFDEFIKVGLVDEKPVRFSGAQA
EGCSPIAQAFAAGRDFITPVKPNTIAKSIAIGNPADGPYAIDIANRTGGSIAAVTDEEII
DGIKLLAEMEGVFTETAGGTTIAVLKKLVEQGKIDPSETTVAYITGNGLKTTEAIASSIG
APYTIEPQLASFHEAWERSQACHGGAAPRA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggtcggctttattggcggcctccggacaccgctgttagcgtgtcccccagtg
atcgggattcccttgaccgccaccctttcccgctccaccttcacgggcctgcgctgcaag
gaatgcggtcatccctacgaagccggcgcccgccacgtctgcgaggacgtctgcttcggc
ccccttgaggtggtctacgactacgacgccatccgcagccgcgtcagccgcgccacgatc
gaggccggccccacctccatctggcgctaccgggaattcctgcccatcgagggcgacccg
atcgacgtcggcaccggcttcacccccctgctgaaggcggatcgcctcgccaggcgcctc
ggcctctcctccctctacatcaagaacgacggcgtcaacatgccgacgctgtccttcaag
gaccgcgtcgtctcggtggccctcacccgggcccgggaactgggcttcaccacggtcagc
tgcgcctccaccggcaacctggccaactccaccgccgccatcgccgcccatgccggcctg
gagtgctgcgtcttcatccccagtgatctcgagctgggcaaggtgctcggcaccctcgtc
tacaaccccaccttgatggcggtgaagggcaactacgaccaggtcaaccggctctgctcg
gaggtggccaacacctacggctggggcttcgtcaacatcaatctgcgcccctattactcc
gagggctccaagacccttggctacgaggtgatcgagcagctgggctggcagcttcccgac
cacatcgtcgcccccctggcctccggctccctgttcaccaaaatccgcaagggcttcgac
gaattcatcaaggtgggtctcgtcgatgagaagccagtgcgcttcagtggcgcccaggcg
gaaggctgctcccccatcgcccaggccttcgccgccggccgcgacttcatcacgccggtg
aagccgaacacgatcgccaagtcgatcgccatcggcaatccggccgatggcccctatgcc
atcgacatcgccaaccgcaccggcggcagcatcgccgccgtcaccgatgaggagatcatc
gacggcatcaagctgctggccgagatggagggggtgttcaccgaaaccgccgggggcacc
accatcgccgtgctcaagaagctggtggagcaggggaagatcgacccctcggaaaccacg
gtcgcctacatcaccggtaacggcctcaagaccaccgaggccatcgcctcctccatcggc
gctccctacaccatcgagccccagctggccagcttccacgaagcctgggagcgctcccag
gcctgccacggcggcgccgccccccgggcctga

DBGET integrated database retrieval system