KEGG   Cyanobium gracile: Cyagr_0909Help
Entry
Cyagr_0909        CDS       T02359                                 

Definition
Viral (Superfamily 1) RNA helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cgc  Cyanobium gracile
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cgc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
911284..912972
Genome map
AA seq 562 aa AA seqDB search
MREPLQTAQPWVGALALSLAEALPRLHGTPPDPLVGELIAALTAALARGELELDLRGPRP
AEVSEAAWPEGHRRALAASSLAGDPDGPLALEEGRLQWRRWQRQRQAVLEALVDRAGALV
PGGDGEAPGAAEPGAAGPGAAGPGAAEPGAPRSLDARQRQALAAVLRHGLVLLEGGPGTG
KTSTVAAMIAAHRVHQPDARIHLAAPTGKAAGRLRAATGGALPCTTLHRLLESRGDRFGR
HRGRPLDLDLLVVDEVSMVDLGLMGALLEALPSACRLVLVGDPAQLPPIAPGAVLQDLQR
PEHRRRLGGAAITLTTTYRNAGAIAAVAAALRQGLGAAPAPQDPDPIAAIRPLLQALDDT
DNLHWRPCSPRTLPAELLERLRRHQDALARLAGHCRPGSPRGCRALLAERDRLLVMAPQR
QGRWGLEAIHRTLLGARRDGDLQDLPPGTPVLCRRNLPELDLANGDVGVLVGGPGPSARL
LFGDGEGEPLWIHPGQLAGAAEPALALTVHKAQGSEAEEVIVLLPSGTARDGRLLYTALT
RARQAALLISEQEDGPMAGKGP
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagggaacccctccagaccgcccagccctgggtgggagccctcgccctcagcctggcc
gaagctctgccccgtctccatggcaccccccccgatcccctggtcggcgagctgatcgcc
gccctcaccgcggccctggcccggggcgagctggagctggatctgcggggcccgagaccg
gcggaggtcagcgaagccgcctggccagaggggcaccgccgggccctggccgccagttcg
ctcgccggcgatccggacgggcccctggccctggaggagggccgactgcagtggcgccgc
tggcagcggcagcggcaggcggtgctcgaggcgctggtcgatcgggccggagccctggtg
ccgggcggcgacggcgaagctcccggtgctgcggagcccggcgctgcgggtcccggtgct
gcgggtcccggtgctgcggagcccggcgccccccggagcctcgatgcccggcagcggcag
gcgttggcggcggtgctccgccacggtctggtgctgctggagggtggacccggcaccggc
aagaccagcacggtggcggccatgatcgcggcccaccgggtgcaccagcccgacgcccgc
atccatctggcggcgcccaccggcaaggcggcgggccggctgcgggcggccaccgggggc
gcccttccctgcaccaccctgcaccggctgctggagagccgcggcgaccggttcggccgc
caccgcggccgccccctcgacctcgacctgctggtggtcgatgaggtctcgatggtggat
ctgggcctgatgggcgccctgctggaggctctgcccagcgcctgtcggctggtgctggtg
ggcgacccggcccagctgcccccgatcgctcccggggccgtgctgcaggacctgcagcgg
cccgaacaccgccgccggctggggggcgccgccatcaccctgaccaccacctaccgcaac
gccggggccatcgccgccgtggccgccgccctgcgccaggggctgggagcggcccccgcc
ccgcaggatccggatccgatcgccgccatccgccccctgctgcaggccctggatgacacc
gacaacctgcactggcgcccctgctccccccggactctgccggcggagctgctggagcgg
ctgcgccgccaccaggacgcgctggccaggctggcggggcattgccggccgggctccccc
cggggatgccgggcgctgctggcggaacgggaccgcctgctggtgatggcgccccaacgc
cagggacgctggggcctggaggcgatccaccggaccctgctgggggctcggcgggacggc
gacctgcaggatctccccccgggcacccccgtcctctgccgccgcaacctgccggaactg
gacctggccaacggcgatgtgggcgtgctcgtgggcggccccgggccctcggcgcgcctg
ctgttcggggacggggagggggagccgctctggatccatcccggccagctggccggggcc
gccgaaccggccctcgccctgacggtccacaaggcccagggcagcgaagccgaggaggtg
atcgtgctgctgcccagcggcaccgcccgcgacgggcggctgctctacaccgccctgacc
cgggcgcggcaggcggcccttctgatcagcgagcaagaggacgggcccatggccgggaaa
ggcccgtaa

DBGET integrated database retrieval system