KEGG   Cyanobium gracile: Cyagr_0929Help
Entry
Cyagr_0929        CDS       T02359                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cgc  Cyanobium gracile
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cyagr_0929
DNA repair and recombination proteins [BR:cgc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cyagr_0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
932286..932924
Genome map
AA seq 212 aa AA seqDB search
MGRLDCFPPAAGSLSGFTRPLARLIDQFERLPGIGPRTAQRLALHLLRQPEEQIRSFADA
LLAARSQVGQCRRCFHLSAEELCEICRNEERRNGQICVVADSRDLLAMERSREFHGQYHV
LGGLISPMDGIGPELLQIQPLVERVDREGAIEVILALTPSVEGDTTSLYLARLLKPFTSV
TRIAYGLPVGGELEYADEVTLARAFEGRRRME
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgggccgcctagattgctttccacctgcagccggttcgctgagcggtttcacccgaccc
ctggcccggctgatcgaccagttcgaacgactgcccggcatcgggccccgcacggcccag
cggctggccctgcacctgctgcgccagcccgaggagcagatccgcagcttcgccgatgcc
ctgctggcggcccgcagccaggtgggccagtgccgacgctgtttccatctctcggccgag
gaactctgcgagatctgccgcaacgaggagcgccgcaacgggcagatctgtgtggtggcc
gactcccgcgacctgctggcgatggaacgcagccgtgaattccacggccagtaccacgtg
ctgggcggactgatctcgccgatggatggcatcggtccggagctgctgcagatccagccc
ctggtggagcgggtcgaccgggagggggcgatcgaggtgatcctggccctcacccccagc
gtggagggggacaccaccagcctctacctggcgcggctgctcaagcccttcaccagcgtc
acccgcatcgcctacgggctgccggtggggggagagctggaatacgccgatgaggtgacc
ctggcccgggcgttcgaaggacgccggcgcatggaatga

DBGET integrated database retrieval system