KEGG   Cyanobium gracile: Cyagr_0993Help
Entry
Cyagr_0993        CDS       T02359                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cgc  Cyanobium gracile
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cyagr_0993
Enzymes [BR:cgc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Cyagr_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
985964..987178
Genome map
AA seq 404 aa AA seqDB search
MNDPSSGRPSDAADAFDRGRHPAGSEGARALEKEASLPLTGWQQEVDQGHRYGLEAAESI
VDRRISTFSRGELPHFAGINTFMKAPYIEDVNRVGEFDVAVVGVPHDSGTTYRPGTRFGP
QGIRRISALYTPYNYEMGVDLREQITLCDVGDIFTIPANNEKSFDQISKGIAHVFASGAF
PIILGGDHSIGFPTVRGVCRHLGDKKVGIIHFDRHVDTQESDLDERMHTTPWFHATNMAN
APAENLVQLGIGGWQVPREGVKVCRERGTNVLTVTDICDMGLEAAARYAIERATDGTDCV
YISFDIDCIDAGFVPGTGWPEPGGLLPREALKLLELIVRNVPVCGLEVVEVSPPYDISDM
TSLMATRVICDTMAHLVVSGQLPRKSAPAWLSRDCNMQVDRAWR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatccgtccagcggccgcccgtccgatgcggccgacgccttcgaccggggccgc
cacccggccggcagtgaaggggcccgggccctggagaaggaagcctccctgcccctcacc
ggctggcagcaggaggtcgaccaggggcaccgctacggcctggaggcggccgagagcatc
gtcgaccggcgcatctccaccttctcccgcggggagctgccgcacttcgcgggcatcaac
accttcatgaaggcgccctacatcgaggacgtgaaccgcgtcggcgagttcgacgtggcc
gtggtgggcgtcccccacgacagcggcaccacctaccggcccggcacccgcttcggcccc
cagggcatccggcgcatctcggccctctacaccccctacaactacgagatgggggttgac
ctgcgcgagcagatcaccctctgcgacgtgggtgacatcttcaccatccccgccaacaac
gagaagagcttcgatcagatctccaagggcatcgcccacgtgttcgccagcggcgccttc
ccgatcatcctgggcggcgaccactcgatcggcttccccaccgtccggggcgtctgccgc
catctcggcgacaagaaggtgggcatcatccacttcgaccgccacgtcgacacccaggag
agcgacctcgacgagcgcatgcacaccaccccgtggttccatgccaccaacatggccaac
gccccggccgagaacctggtgcagctgggcatcggtggctggcaggtgccgcgggaaggg
gtgaaggtctgccgcgagcggggcaccaacgtgctcaccgtcaccgacatctgcgacatg
ggcctggaggcggcggccaggtacgccatcgaacgggccaccgacggcaccgactgcgtc
tacatctccttcgacatcgactgcatcgatgccggtttcgtgccgggcaccggctggccc
gagcccggcggtctgctgccgcgggaagccctcaagctgctggagctgatcgtgcgcaac
gttccggtctgcggcctggaggtggtggaggtctccccgccctacgacatcagcgacatg
acctccctgatggccacccgggtcatctgcgacaccatggcccacctggtggtgagcggc
cagctgccccggaagtcagcccccgcctggctctccagggactgcaacatgcaggtcgac
cgcgcctggagatag

DBGET integrated database retrieval system