KEGG   Cyanobium gracile: Cyagr_1213Help
Entry
Cyagr_1213        CDS       T02359                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cgc  Cyanobium gracile
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cyagr_1213
Enzymes [BR:cgc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Cyagr_1213
Peptidases [BR:cgc01002]
 Cysteine Peptidases
  Family C44
   Cyagr_1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1214505..1216325
Genome map
AA seq 606 aa AA seqDB search
MCGIAGQLGKDPGDFAARVGPRLAHRGPDDAGVWQDANACLVHRRLAILDLSPLGHQPMA
SACGRWQLVFNGEIYNHGELRRRLEAEGQRFRGSGDTEVLLAWLVSRGLDGLEALRGMFA
FCLYDTRERSALLARDPHGIKPLYLRSGPGGCLAFASELRALLAADGEAPPLNRRALGRY
LATGSVSEPDTLVAGVQRLPCGHAATWRQGRLTVQPWGALPESLVGATGAGSMAAAEAVA
LTRSALEDSVAAHMVSDVPVGLFLSAGLDSASLLALAPRGLHTFTIGFQTPGAGGFDESG
PAARIAAHFGAHHTPLNLSADQARQWLPAFLASQDQPSIDGYNTWCVSKLATEHGLKVAL
SGLGGDELFGGYPSFRMVPKLRRWRRLIGPAGPPAAWLLQRMPQGRRARLQRIAGLLQAP
ASLAGAYGCFRGLFSPAETERLLAHWGLRPEPAAVPSTADGNGAAPGGREGVAWLEGTRY
LRNQLLPDSDVMAMAAGLELRLPLVDAQLQRRLAPIPAALRLAEGKQLLARSVPELPDWF
LNRPKQGFRFPFQLWLDDPASPLALRLPSTPRGIDLAPWYRRWSLMVLQHWLQAHLGLSL
SPAPRP
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcgcgggccagctggggaaggacccgggcgacttcgccgccagggtcggc
ccgcgactcgcccaccgggggccggatgatgccggcgtctggcaggacgccaacgcctgc
ctggtgcaccggcgcctggcgatcctggatctctcccccctgggccaccagccgatggcc
tccgcctgcggccgctggcagctggtgttcaacggcgagatctacaaccatggcgaactg
cgccgccggctcgaggcggagggccagcgcttccggggcagcggcgacacggaggtgctg
ctggcctggctggtgagccggggcctggacgggctggaggcgctgcggggcatgttcgcc
ttctgcctctacgacacccgggagcgcagtgccctgctcgcccgcgatccccacggcatc
aagccgctctacctgcgcagcggcccggggggctgcctcgccttcgcctcggagctgcgg
gccctgctggccgccgacggcgaggcgccgcccctgaaccgccgggccctggggcgctac
ctggccaccggctcggtgagtgagcccgacaccctggtggcgggggtgcagcgcctgccc
tgcggccacgccgccacctggcgccagggtcggctgacggtgcagccctggggggctctg
ccggagagcctcgtgggcgccaccggcgccggctccatggcggccgccgaggcggtggcc
ctcacccgctcggccctcgaggattcggtggcggcccacatggtcagcgatgtgccggtg
gggctgttcctcagcgccgggctcgattccgcctccctgctggcgctcgccccccggggc
ctgcacaccttcaccatcggcttccagacgccgggcgccggtggtttcgatgaatccggg
ccggcagcccgcatcgccgcccacttcggggcccatcacacccccctgaacctcagcgcc
gaccaggcccgccagtggctgccggccttcctggccagccaggaccagccctccatcgat
ggctacaacacctggtgtgtctccaagctggccacggagcacgggctgaaggtggccctc
tccgggctcggcggggatgagctgttcggcggctaccccagcttccggatggtgccgaag
ctgcggcggtggcggcgcctgatcggtcccgccggtccaccggcggcgtggctgctgcag
cggatgccccaggggcgccgcgcccggctgcagcggatcgccgggctcctgcaggcaccc
gcctccctggccggggcctacggctgcttccggggcctgttctcccccgcagagaccgag
cgtctgctggcgcactgggggctccgccctgagcccgctgccgtgccgtcgaccgccgat
ggcaacggcgcagcgccggggggccgcgaaggggtggcctggctggagggcacccgctac
ctccgcaaccagctgctgccggacagcgacgtcatggcgatggccgccgggctggagctg
cgcctgcccctggtggacgcccagctgcagcgccggctggctccgatccccgccgccctg
cggctggcggagggcaagcagctgctggcccgcagcgtgccggagctgcccgactggttc
ctgaaccgccccaagcaggggttccgcttcccgtttcagctctggctggacgacccggcg
tcgcccctggccctgcggctgccctcgacaccccgggggatcgatctggcgccctggtac
aggcgctggagcctgatggtgctccagcactggctgcaggcgcacctcggcctcagcctt
tcgccggcgccccgcccatga

DBGET integrated database retrieval system