KEGG   Cyanobium gracile: Cyagr_1248Help
Entry
Cyagr_1248        CDS       T02359                                 

Definition
bile acid beta-glucosidase
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cgc  Cyanobium gracile
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cyagr_1248
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cyagr_1248
Enzymes [BR:cgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cyagr_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1248775..1251282
Genome map
AA seq 835 aa AA seqDB search
MVPFGLSALQNLRRGRGPWQPPEASWSRPFGQGWSQPYTVRYASNLDDGPNHGMPLGGFG
AGCLGRGLDGAFNLWHLDGGEHWFGVLPDCQFALFEQDGDGRRAHALATAPQADDSRPGS
GPPLASWNWYPAATPEQPSGTVAVRYPISSHHYAAVFSADVRCEAFSPILPGDYRRTSYP
VAVFAWTFSNPTNQPLELSLLLSWRNTVGWFTNTDPAAEVHFRDDGSPEHNYVPAIGRGK
GQRNRWVDGAGLKGLLLEGERTQPLAEGEGQWCLAVPDEAALNHPGVEVFRCSRWDPSGD
GAELWEPFSRDGSIPDSDNDRRSTGDDPLSAALAVRFRLEPGASLEIPVVISWDLPVTAF
ATGTRALRRYTDFFSAEGDSAAAIAGEALADWRDWQAAIEAWQAPVVQRHDLAEPLRMAL
LNELYDLASGGSLWTAASPGDPVGRFGVLECLDYAWYESLDVRLYGSFALLQLWPELDKA
VLRSFARAIPAADPTPRPIGWYFTQGRGRVEAARKVAGATPHDLGAPNERPFDATNYTAY
QDCNLWKDLASDYVLQVWRTYSLAPSGPDIRFLADCWPAAVTALDYLKQFDVNDDGLPDN
GGAPDQTFDDWPLQGVSAYCGALWIAALEAALAIGQRLQLELGLDTAEEQRRFGGWLEQS
RSHFDTLLWNGEYYAIDAGSGTPVVMADQLCGDFYARLLALPPVVADERALSSLKAIRQA
CFESFEGGRLGVANGLRRDGTPLDPEGTHPLEVWTGINFGLAAYYRLMGQSSTAFAITGA
VVRQVYEGGLQFRTPEAITAAGTFRACHYLRAMAIWALWATHTGWQPIPGAERQP
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccttcggcctctccgctctccagaacctgcggcgcggcaggggtccctggcag
ccccccgaggccagctggtcgcggccgttcggccagggctggagccagccctacacggtg
cgctacgccagcaacctcgacgacggccccaaccacggcatgcccctggggggcttcggc
gccggctgcctggggcggggcctcgacggcgccttcaacctctggcacctcgacgggggg
gagcactggttcggcgtgctgcccgactgccagttcgcccttttcgagcaggacggcgac
gggcggcgggcccatgccctggccacagcgccccaggccgacgattcccgccccggctcc
ggcccgccgctggcctcctggaactggtaccccgccgccaccccggagcagcccagcggc
accgtggcggtgcgctacccgatcagctcccatcactacgccgcggtgttcagcgccgac
gtgcgctgcgaagccttcagcccgatcctccccggcgactaccgccgcaccagctacccg
gtcgccgtgttcgcctggacgttcagcaacccaacgaatcagccgctggagctgtcgctg
ctgctgagctggcgcaacaccgtcggctggttcaccaacaccgacccggcggcggaggtc
cacttccgggatgacggcagcccggagcacaactacgtgccggcgatcggccgcggcaag
gggcagcgcaaccgctgggtcgacggggccggcctcaagggcctgctgctggagggggag
cgcacccagcccctggcggaaggggaaggacagtggtgcctggcggtacccgacgaggcg
gcgctgaaccacccgggggtggaggtgttccgctgcagccgctgggatcccagcggtgac
ggggcggaactctgggaacccttcagccgcgatggctcgatccccgacagtgacaacgac
cgccgcagcaccggcgacgatcccctcagcgccgccctggcggtgcgcttccggctggag
ccgggcgcctcgctggagattcctgtggtgatcagctgggacctgcccgtgacggccttc
gccaccggcacccgggccctgcgccgctacaccgacttcttctccgccgaaggcgacagc
gccgctgccatcgccggcgaagccctggccgactggcgcgactggcaggccgcgatcgag
gcctggcaggcgccggtggtgcaacgccacgacctggcggaaccgctgcgcatggcgttg
ctcaacgagctctacgacctggccagtggcggcagcctctggacggccgccagccccggc
gatccggtgggccgcttcggagtgctcgagtgcctcgactacgcctggtacgagagcctc
gacgtgcggctgtacggctccttcgccctgctgcagctgtggcccgagctcgacaaggcg
gtgctgcgcagcttcgcccgcgccatcccggccgccgatccgacgccgcggccgatcggc
tggtatttcacccaggggcggggccgggtggaggcggcccgcaaggtggccggcgccacc
ccccacgacctcggggccccgaacgagcgccccttcgacgccaccaactacaccgcctac
caggactgcaacctctggaaggacctggccagcgattacgtgctgcaggtctggcgcacc
tacagcctggcccccagcggaccggacatccgtttcctggcggactgctggccggcggcg
gtgaccgccctcgactacctcaagcagttcgacgtcaacgacgacggactgcccgacaac
ggcggtgccccggaccagaccttcgacgactggcccctgcagggtgtgagcgcctactgc
ggcgccctctggatcgctgccctggaggcggccctggccatcggccagcgtctccagctg
gagctggggctcgacactgccgaggagcaacggcgcttcggcggctggctcgagcagtcc
cgaagccatttcgataccctgctctggaacggcgagtactacgccatcgatgccggcagc
ggcaccccggtggtgatggccgaccagctctgcggcgacttctacgcccggctgctggcg
ctgccaccggtggtggccgacgagcgcgccctctcctccctcaaggcgatacgtcaggcc
tgctttgagtccttcgagggcggccgtctgggggtggccaatggcctgcgccgcgatggc
acccccctcgatcccgagggaacccatccgctggaggtctggaccggcatcaacttcggc
ctggccgcttactaccggctgatgggacagagcagcaccgccttcgccatcaccggtgcc
gtcgtgcgccaggtgtacgagggcggcctgcagttccgcacaccggaggcgatcaccgcg
gccggcaccttccgcgcctgccactacctgcgggccatggcgatctgggccctgtgggcg
acccacaccggctggcagccgatccccggcgccgagcgccagccatga

DBGET integrated database retrieval system