KEGG   Cyanobium gracile: Cyagr_1289Help
Entry
Cyagr_1289        CDS       T02359                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cgc  Cyanobium gracile
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyagr_1289
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyagr_1289
   00020 Citrate cycle (TCA cycle)
    Cyagr_1289
   00620 Pyruvate metabolism
    Cyagr_1289
Enzymes [BR:cgc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyagr_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(join(1301787..1302911,1302913..1303119))
Genome map
AA seq 443 aa AA seqDB search
MPALSSTMTEGKIVEWLKKPGERVERGESVLVVESDKADMDVEAFQEGFLAAVLMEAGST
APVGETIGLSWRAKRRLPRPGPRHRHLPRQHPPPLPPPLRPPHLLQLRRPPPPPRPRPHR
LPPPWPPRPRGASRRCQRRPGGGHPRARKLAAQLGVALASVRGTGPNGRIQAEDVEQATG
QPVSVPRVAEGTAPAMVAPAAGNGAAAAPAAPAGQAFGRAGETVAFNTLQQAVVRNMNAS
LAVPCFHVGYTITTDRLDAFYKQVKAKGVTMTALLAKAVGITLARHPQLNASASDAGMAY
PASINVAVAVAMDDGGLITPVLAAADRTDLYSLSRQWADLVARSRSKQLKPEEYTTGTFT
LSNLGMFGVDRFDAILPPGTGAILAVAASRPMVAALKDGSIAVRRQMQVNLTADHRVIYG
THAAAFLKDLADLIENRPESLAL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccggccctcagctccaccatgacggagggcaagatcgtggagtggctcaagaaaccc
ggtgagcgggtcgagcggggcgagtcggtgctcgtggtcgagtccgacaaggcggacatg
gatgtggaggccttccaggagggcttcctggctgccgtgctgatggaggcgggcagcacc
gcgccggtgggagagacgatcggcctgtcgtggagagcgaagcggagattgccgcggcca
gggccgcggcaccggcacctgccacggcagcacccacccccgctcccgccacccctgcgg
ccgccgcacctgctccagctgcggcgccccccacccccgccccggcctcgcccccaccgg
ctcccgcccccgtggccgccccggccccggggcgcttcccgccgctgccagcgacggccg
ggtggtggccacccccgggcccgcaagctggcggcccagctcggtgtggccctggcctcc
gtgcggggcaccggccccaatggccggatccaggccgaggacgtggagcaggccaccggc
cagcccgtcagcgtgccgcgggtggccgaaggcaccgctccggccatggtcgccccggcg
gccggcaatggcgcggcggccgccccagccgcccccgctggccaggccttcggtcgcgcc
ggcgagaccgtggccttcaacaccctgcagcaggcggtcgtccgcaacatgaacgccagc
ctggcggtcccctgcttccacgtcggctacacgatcaccaccgaccggctcgacgccttc
tacaagcaggtgaaggccaagggcgtcacgatgacggccctgctggccaaggcggtgggt
atcaccctggcccgccacccgcagctgaacgcgtcggccagtgacgcgggcatggcttac
ccggcctccatcaacgtggccgtggccgtcgccatggatgacggcggcctgatcaccccg
gtgctggccgccgccgaccgcaccgatctctattcgctctcgcgccagtgggccgacctg
gtggcccgctcccgctccaagcagctcaagccggaggagtacaccaccggcaccttcacc
ctctccaatctgggcatgttcggggtcgatcgcttcgacgcgatcctgccgccgggcacc
ggcgccatcctggcggtcgccgcctcccggcccatggtcgcggccctcaaggacggttcg
atcgccgtgcggcgccagatgcaggtcaacctcaccgccgatcaccgcgtcatctacggc
acccatgccgccgccttcctcaaggatctggccgacctgatcgagaaccggcccgaaagc
ctggccctctga

DBGET integrated database retrieval system