KEGG   Cyanobium gracile: Cyagr_1289Help
Entry
Cyagr_1289        CDS       T02359                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cgc  Cyanobium gracile
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cgc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cgc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cgc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cgc00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(join(1301787..1302911,1302913..1303119))
Genome map
AA seq 443 aa AA seqDB search
MPALSSTMTEGKIVEWLKKPGERVERGESVLVVESDKADMDVEAFQEGFLAAVLMEAGST
APVGETIGLSWRAKRRLPRPGPRHRHLPRQHPPPLPPPLRPPHLLQLRRPPPPPRPRPHR
LPPPWPPRPRGASRRCQRRPGGGHPRARKLAAQLGVALASVRGTGPNGRIQAEDVEQATG
QPVSVPRVAEGTAPAMVAPAAGNGAAAAPAAPAGQAFGRAGETVAFNTLQQAVVRNMNAS
LAVPCFHVGYTITTDRLDAFYKQVKAKGVTMTALLAKAVGITLARHPQLNASASDAGMAY
PASINVAVAVAMDDGGLITPVLAAADRTDLYSLSRQWADLVARSRSKQLKPEEYTTGTFT
LSNLGMFGVDRFDAILPPGTGAILAVAASRPMVAALKDGSIAVRRQMQVNLTADHRVIYG
THAAAFLKDLADLIENRPESLAL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgccggccctcagctccaccatgacggagggcaagatcgtggagtggctcaagaaaccc
ggtgagcgggtcgagcggggcgagtcggtgctcgtggtcgagtccgacaaggcggacatg
gatgtggaggccttccaggagggcttcctggctgccgtgctgatggaggcgggcagcacc
gcgccggtgggagagacgatcggcctgtcgtggagagcgaagcggagattgccgcggcca
gggccgcggcaccggcacctgccacggcagcacccacccccgctcccgccacccctgcgg
ccgccgcacctgctccagctgcggcgccccccacccccgccccggcctcgcccccaccgg
ctcccgcccccgtggccgccccggccccggggcgcttcccgccgctgccagcgacggccg
ggtggtggccacccccgggcccgcaagctggcggcccagctcggtgtggccctggcctcc
gtgcggggcaccggccccaatggccggatccaggccgaggacgtggagcaggccaccggc
cagcccgtcagcgtgccgcgggtggccgaaggcaccgctccggccatggtcgccccggcg
gccggcaatggcgcggcggccgccccagccgcccccgctggccaggccttcggtcgcgcc
ggcgagaccgtggccttcaacaccctgcagcaggcggtcgtccgcaacatgaacgccagc
ctggcggtcccctgcttccacgtcggctacacgatcaccaccgaccggctcgacgccttc
tacaagcaggtgaaggccaagggcgtcacgatgacggccctgctggccaaggcggtgggt
atcaccctggcccgccacccgcagctgaacgcgtcggccagtgacgcgggcatggcttac
ccggcctccatcaacgtggccgtggccgtcgccatggatgacggcggcctgatcaccccg
gtgctggccgccgccgaccgcaccgatctctattcgctctcgcgccagtgggccgacctg
gtggcccgctcccgctccaagcagctcaagccggaggagtacaccaccggcaccttcacc
ctctccaatctgggcatgttcggggtcgatcgcttcgacgcgatcctgccgccgggcacc
ggcgccatcctggcggtcgccgcctcccggcccatggtcgcggccctcaaggacggttcg
atcgccgtgcggcgccagatgcaggtcaacctcaccgccgatcaccgcgtcatctacggc
acccatgccgccgccttcctcaaggatctggccgacctgatcgagaaccggcccgaaagc
ctggccctctga

DBGET integrated database retrieval system