KEGG   Cyanobium gracile: Cyagr_1332Help
Entry
Cyagr_1332        CDS       T02359                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cgc  Cyanobium gracile
Pathway
cgc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cgc01100  Metabolic pathways
cgc01110  Biosynthesis of secondary metabolites
cgc01130  Biosynthesis of antibiotics
cgc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyagr_1332
Enzymes [BR:cgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cyagr_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NMO Lactamase_B_5 IMPDH
Motif
Other DBs
NCBI-ProteinID: AFY28508
UniProt: K9P6B8
Position
complement(1343552..1344436)
Genome map
AA seq 294 aa AA seqDB search
MEIRRRPPNPSVRVAHLEFGTPHPEESPRHILEEIVWEKDREVTAARERVSLDSLKQQVA
DLPPTRDFAAALRASCRKPAVIAEIKKASPSKGVIREDFDPVAIARGYQDGGASCLSVLT
DKRFFQGGFDVLVAVREAVELPLLCKDFILTPYQLFQARAAGADAALLIAAILTDQDLAY
LLKVARGLGLAVLVEVHDAAEMERVLRLEGVNLIGINNRDLASFSVDLATTEQLMERFGE
QVRARGALLVSESGLFIREDLDRAVGAGADAVLVGEALMRQDDVTAALETLIGG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgtcgccggccccccaacccctcggtgcgggtggcccacctggaattcggc
accccccatcccgaggagagcccacgccacatcctcgaggagatcgtctgggagaaggac
cgggaagtgaccgccgcccgggaacgggtgagcctggactccctcaagcagcaggtggcc
gacctgccccccacccgggacttcgcagcggccctgcgggccagctgccgcaaaccagcg
gtgatcgccgagatcaagaaggccagccccagcaagggggtgatccgggaggatttcgac
cccgtcgccatcgcccggggctaccaagacggcggcgccagctgcctttcggtgctcacc
gacaagcgcttcttccaggggggcttcgatgtgctcgtggcggtgcgggaggcggtggag
ctccccctgctctgcaaggacttcatcctcaccccctaccagctgttccaggcccgggcg
gccggggccgacgccgccctgctgatcgcggcgatcctcaccgaccaggatctggcctac
ctgctcaaggtggcccggggcctggggctggcggtgctggtggaggtgcacgacgccgcc
gagatggagcgggtgctgcggctggagggtgtgaacctgatcggcatcaacaaccgtgac
ctggccagcttctcggtggatctggccaccaccgaacagctgatggaacgcttcggcgag
caggtgcgtgcccgcggcgccctgctggtgagcgaatcgggcctgttcatccgggaggat
ctggatcgggccgtcggcgccggcgccgatgcggtgctggtaggggaggcgctgatgcgc
caagacgacgtgacagcggccctggagaccctgatcgggggctga

DBGET integrated database retrieval system