KEGG   Cyanobium gracile: Cyagr_1332Help
Entry
Cyagr_1332        CDS       T02359                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cgc  Cyanobium gracile
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyagr_1332
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyagr_1332
Enzymes [BR:cgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cyagr_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1343552..1344436)
Genome map
AA seq 294 aa AA seqDB search
MEIRRRPPNPSVRVAHLEFGTPHPEESPRHILEEIVWEKDREVTAARERVSLDSLKQQVA
DLPPTRDFAAALRASCRKPAVIAEIKKASPSKGVIREDFDPVAIARGYQDGGASCLSVLT
DKRFFQGGFDVLVAVREAVELPLLCKDFILTPYQLFQARAAGADAALLIAAILTDQDLAY
LLKVARGLGLAVLVEVHDAAEMERVLRLEGVNLIGINNRDLASFSVDLATTEQLMERFGE
QVRARGALLVSESGLFIREDLDRAVGAGADAVLVGEALMRQDDVTAALETLIGG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgtcgccggccccccaacccctcggtgcgggtggcccacctggaattcggc
accccccatcccgaggagagcccacgccacatcctcgaggagatcgtctgggagaaggac
cgggaagtgaccgccgcccgggaacgggtgagcctggactccctcaagcagcaggtggcc
gacctgccccccacccgggacttcgcagcggccctgcgggccagctgccgcaaaccagcg
gtgatcgccgagatcaagaaggccagccccagcaagggggtgatccgggaggatttcgac
cccgtcgccatcgcccggggctaccaagacggcggcgccagctgcctttcggtgctcacc
gacaagcgcttcttccaggggggcttcgatgtgctcgtggcggtgcgggaggcggtggag
ctccccctgctctgcaaggacttcatcctcaccccctaccagctgttccaggcccgggcg
gccggggccgacgccgccctgctgatcgcggcgatcctcaccgaccaggatctggcctac
ctgctcaaggtggcccggggcctggggctggcggtgctggtggaggtgcacgacgccgcc
gagatggagcgggtgctgcggctggagggtgtgaacctgatcggcatcaacaaccgtgac
ctggccagcttctcggtggatctggccaccaccgaacagctgatggaacgcttcggcgag
caggtgcgtgcccgcggcgccctgctggtgagcgaatcgggcctgttcatccgggaggat
ctggatcgggccgtcggcgccggcgccgatgcggtgctggtaggggaggcgctgatgcgc
caagacgacgtgacagcggccctggagaccctgatcgggggctga

DBGET integrated database retrieval system