KEGG   Cyanobium gracile: Cyagr_2123Help
Entry
Cyagr_2123        CDS       T02359                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cgc  Cyanobium gracile
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyagr_2123
Enzymes [BR:cgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Cyagr_2123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2048397..2049005)
Genome map
AA seq 202 aa AA seqDB search
MEASCSRTLAIALGANLGIPAVTLVAVRPLLSEAIDAWVAHGERPAEVARPLWRHWSPLF
MTVPVGGPPGQPPYLNAVLLVERDAAGPDLHPWPSPDALLGRLLALERRFGRERRERWGP
RSLDLDLLWCGDHLCRSPELVLPHPRLGERTFVLAPLAAIDPHQPLPGEDVSVAERLADL
LARPGEIPPERLSGRTGWPEGP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaggcctcctgctctcgcacactcgccatcgcccttggtgccaacctcggtattccg
gcggtcacgcttgtggcggtacggccgctgctgagcgaagccatcgacgcttgggtggcc
catggggagcggccggcagaggtcgctcggccgttgtggcggcactggtcgccgctcttc
atgacggtgccggtgggcgggccgccagggcagcctccctacctgaacgccgtcctgctg
gtggagcgggacgcggccgggcccgacctccatccctggccttcgccggatgctctgttg
gggcgattgctggcgctggagcggcgtttcggccgggagaggcgcgaacgctggggaccc
cgcagcctcgatctcgacctgctctggtgcggcgaccacctctgccgcagcccggagctg
gtgttgccccatccgcggctgggagagcgcacgttcgtgcttgcccccctggcggcgatc
gatccccaccagcctctgccgggagaggacgtgagcgtggccgagcggctggcggacctg
ctggcccggcctggcgagatccctcctgagcggctctcgggccggaccggctggcccgaa
ggtccctga

DBGET integrated database retrieval system