KEGG   Cyanobium gracile: Cyagr_2392Help
Entry
Cyagr_2392        CDS       T02359                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cgc  Cyanobium gracile
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyagr_2392
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyagr_2392
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cyagr_2392
Enzymes [BR:cgc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cyagr_2392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2314783..2315913)
Genome map
AA seq 376 aa AA seqDB search
MTSATPLSPVPLLRALRRLGRQPTMQDWPGLIEAYRSWLPVSDATPVVTLREGATPLIPA
PVIAERVGRGVKVFLKYDGLNPTGSFKDRGMTMAISKAKEAGSEAVICASTGNTSAAAAA
YARRGGMRAFVLIPDGYVAQGKLAQALLYGAEVLAVQGNFDRALAIVRDVADRYPVTLVN
SLNPYRLQGQKTAAFEVVDALGEAPDWLCIPVGNAGNISAYWMGFKEYRQAGHSTVLPRM
MGFQAAGAAPMVLGHTVEQPDTIATAIRIGNPVNKENALNARSESNGDFMAVTDAEIIEA
YKLLGQGEGVFCEPASAASVAGLIKRREEVPAGATVVCVLTGNGLKDPTTAIENNDATFH
TGIAPDTETVAKVMGF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgacgtcagccacgccgctgtcccccgtgcccctgctacgagccctgcgacgcctgggc
cggcagcccaccatgcaggactggccggggctgatcgaggcctaccgcagctggctgccc
gtcagtgacgccacgccggtggtgaccctgcgggagggggccacgcccctgattccggcg
ccggtgatcgccgaacgggtgggccgcggcgtcaaggtgttcctcaagtacgacggcctc
aaccccaccggctccttcaaggaccggggcatgacgatggccatcagcaaggccaaggag
gcgggctcggaggcggtgatctgcgccagcaccggcaacacatcagcagccgcggccgcc
tacgcgcgccggggcgggatgcgggccttcgtgctgatccccgacggctacgtggcccag
gggaagctggcccaggccctgctctacggcgccgaggtgctggcggtgcagggcaacttc
gaccgggccctggcgatcgttcgggacgtggctgaccgctacccggtcaccctggtgaac
tccctcaacccgtaccggctgcaggggcagaagacggccgccttcgaggtggtcgacgcc
ctcggcgaagcccccgactggctctgcatcccggtgggcaacgccggcaacatcagcgcc
tactggatgggcttcaaggagtaccgccaggcgggccacagcacggtcctgccgcggatg
atgggcttccaggccgccggggccgccccgatggtgctggggcacaccgtggagcaaccg
gacaccatcgccacggcgatccgcatcggcaatccggtgaacaaggagaacgccctcaac
gcccgcagcgagagcaacggcgacttcatggccgtcaccgacgccgagatcatcgaggcc
tacaagctgctgggccagggggaaggggtgttctgcgagcccgccagcgccgcctcggtg
gcgggcctgatcaagcggcgggaggaggtgcccgccggcgccacggtggtgtgcgtgctc
accggcaacggcctcaaggacccgacgacggcgatcgagaacaacgacgccaccttccac
accggcatcgccccggacaccgagaccgtggccaaggtgatgggcttctga

DBGET integrated database retrieval system