KEGG   Cyanobium gracile: Cyagr_2711Help
Entry
Cyagr_2711        CDS       T02359                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cgc  Cyanobium gracile
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cgc01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cgc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2623547..2624479)
Genome map
AA seq 310 aa AA seqDB search
MRVPLQDTSHSRKKAQLLAAMERPRPPLPANQRKFKTGTTGFMLAIHVGAVFALLPRFWS
FQGVIVLAVLYWATVLGVTLGLHRLVAHRGFEAPRWVERLLVLMGTLACQSGPIEWVGLH
RHHHLFSDQPNDHHDAARGLWWAHSEWMLHRIPALTEIHRFTGDMEKDPFYRWLDRWFLL
LQLPLGAALYWYGNWAGVHGGGLGLVLWGIPLRLVLVYHVTWLVNSATHAFGYRNFDCPD
RSRNCWWVALLTFGEGWHNNHHAYPHSARHGLRWFEFDITWQHIRALRALGLARKVRIAP
VFGRRADAAA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtacccctgcaggacaccagccactctcgcaagaaggcccagctgctggcggcc
atggaacggccccggccgcccctgccggcgaaccagcgcaagttcaagaccggcaccacc
ggcttcatgctggccatccacgtgggggcggtcttcgccctgctgccgcgcttctggagc
ttccagggggtgatcgtgctggcggtcctctactgggccacggtgctgggggtgaccctg
gggctgcatcgcctggtggcccaccggggcttcgaggcaccccgctgggtggagcggctg
ctggttctgatgggcaccctggcctgccagagcggaccgatcgaatgggtgggcctgcac
cgccaccaccacctcttctccgaccagcccaacgaccaccacgacgccgcccgcggcctc
tggtgggcccacagcgagtggatgctgcacaggatcccggccctcaccgagatccaccgc
ttcaccggcgacatggagaaggaccccttctaccgctggctggaccgctggttcctgttg
ctgcagctgcccctgggggccgccctctactggtacggcaactgggcgggggtccatggc
ggcggcctggggctggtgctctggggcatccccctgcgcctggtgctcgtctatcacgtc
acctggctggtgaactccgccacccatgccttcgggtaccgcaacttcgactgccccgac
cgctcccgcaactgctggtgggtggccctgctgaccttcggcgagggctggcacaacaac
caccacgcctatccccattcggcccgccacgggctgcgctggttcgagttcgacatcacc
tggcagcacatccgcgccctgcgggccctcggcctggccaggaaggtgcgcatcgccccg
gtcttcggccgtcgcgccgacgccgccgcctga

DBGET integrated database retrieval system