KEGG   Cyanobium gracile: Cyagr_2945Help
Entry
Cyagr_2945        CDS       T02359                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cgc  Cyanobium gracile
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyagr_2945
Enzymes [BR:cgc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cyagr_2945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2878667..2879470)
Genome map
AA seq 267 aa AA seqDB search
MAGTTPLAGRTIAVTRAETQLGAARQLFEQAGASVIDLPALVIGPPDLWGPLDDALAELD
QFHWILFSSANGVDAVEQRLVRRGSSLAGRPRGVRLAAVGRKTAEALEALGAPADFVPPA
FVADSLIEHFPVSGWGQRLLLPRVQSGGRTVLAEAFAAAGARVVEVAAYETRCPAGLPSG
ALQALERRGVDAITFSSGKTVDHTAQLLAGSFGENWIEWLEGVQVVSIGPQTSRRCLERL
GRVDGEADPHDLEGLVAACSRALRARP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggccgggacaaccccactggcgggccgcacgatcgccgtgacccgggccgaaacccag
ctgggcgccgcccgccagctgttcgagcaggccggcgccagcgtcatcgacctgccggcc
ctggtgatcgggccccccgatctctgggggcccctcgacgatgccctggcggaactggat
cagttccactggatcctcttctcgagcgccaacggggtggacgccgtggagcagcggctg
gtccgccgggggagcagcctggccggacggccccggggggtgcggctggcggcggtgggg
cgcaagaccgccgaggccctggaggccctgggggcccccgccgatttcgtgccgccggcg
ttcgtggccgacagcctgatcgagcacttcccggtgtcgggctgggggcagcggctgctg
ctgccgcgggtgcagagcggcggacgcacggtgctcgcggaggccttcgccgcggccggc
gcccgggtggtggaggtggccgcctacgagacccgctgtccggccggacttcccagtggg
gccctgcaggccctggagcggcgcggggttgatgccatcaccttcagcagcggcaagacg
gtggaccacaccgcccagctgctggccggcagcttcggcgagaactggatcgagtggctg
gagggggtgcaggtggtctcgatcggcccccagaccagccgccgctgcctggagcggctc
ggacgggtggacggggaagcggatccccacgacctggagggcctggtggccgcctgcagc
cgggccctcagagctcgaccttga

DBGET integrated database retrieval system