KEGG   Cyanobium gracile: Cyagr_2977Help
Entry
Cyagr_2977        CDS       T02359                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cgc  Cyanobium gracile
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cgc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2911656..2912504)
Genome map
AA seq 282 aa AA seqDB search
MPELPEVETVRRGLELQTSGLVIERVEVLRARAIASPEDPADFCRALRGLCVGRWLRRGK
YLLADLQAPDGSPAGRWGVHLRMTGQFLWLAEDRPPCSHTRVRVWSRGGEELRFVDTRSF
GQMWWVPPGVADETVMGGLRRLGPEPFGADFTGAYLRQRLKGSRRPIKNALLDQSLVAGV
GNIYADESLFAAGILPQTPSGRLPLSRLERLRLALVEVLETSIGAGGTTFSDFRDLQGTN
GNYGGQAWVYRRGGSPCRRCGTAILREKLGGRSSHWCPRCQS
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctcccggaggttgaaaccgtacgccgggggctcgagcttcagacgtccggt
ctcgttatcgagcgtgtcgaggtgctccgcgcccgcgccattgccagccccgaagaccct
gccgatttctgcagggcgcttcggggcctttgtgtgggccggtggctgcgccgcggcaag
tacctcctggccgatctccaggccccggacggcagccccgcaggccgctggggggtgcat
ctgcgcatgaccggccagtttctgtggctggcggaggaccgtcccccctgctcccacacc
cgggtgcgggtctggagcaggggcggcgaagaactgcgctttgtcgacacccgcagtttc
ggccagatgtggtgggtgccgcccggggtcgccgacgagaccgtgatgggcggtctgcgg
cgcctggggcccgaacccttcggagcagatttcaccggcgcctacctgcggcagcggctc
aagggctcacgccgtccgatcaagaacgctctgctcgatcagtcgctggtggcgggagtg
ggaaacatctacgccgatgaatccctgttcgcggcagggatcctgccccagacacccagc
ggccgtctgccgctgagccggctggagcggctgcgcctggccctggtggaggtgctggag
accagcatcggcgccggtggcaccaccttcagtgatttccgggacctgcagggcaccaat
ggcaactacggcggccaggcctgggtgtaccgccgcggcggatccccctgccgccgttgc
ggcacggcgatcctgcgcgagaagctgggggggcgcagcagtcactggtgcccccgctgc
cagagctga

DBGET integrated database retrieval system