KEGG   Cyanobium gracile: Cyagr_3185Help
Entry
Cyagr_3185        CDS       T02359                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cgc  Cyanobium gracile
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cyagr_3185
Enzymes [BR:cgc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Cyagr_3185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3103576..3104181
Genome map
AA seq 201 aa AA seqDB search
MLKLHGHELSGNSYKVRLLLELLGLDYDWVRVDLMAGEHKGEAFLAINPFGQVPVLQEDG
ITLSDAQAILFFLAARQGDGRWLPADPLGQARVVRWLSTAAGEVRQGPESARLHHLFGVK
AIPIERATEKAGFLLDQLERHLTPRLWLEFERPTIADIAVFPYVALAPDGGIDLAPYPRV
RDWIGRIKALPGYVPMKGLEA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagctccacggccacgaactctccggcaacagctacaaggtgcgcctgctcctg
gaactgctcgggctcgactacgactgggtccgcgtcgatctgatggccggcgagcacaag
ggggaggcgttcctcgccatcaatcccttcggccaggtgcccgtgcttcaggaggacggc
atcacgctctccgacgcccaggcgatcctcttctttctggcggcccgccagggggacgga
cggtggctgcccgccgatcccctgggccaggcccgggtggtgcgctggctctccaccgcg
gccggtgaggtgcgccaggggccggaaagcgcccggctgcaccatctgttcggcgtcaag
gcgattccgatcgagcgggccaccgagaaggccggcttcctcctcgaccagctggagcgg
cacctgaccccgcggctgtggctggagttcgagcgccccaccatcgccgacatcgccgtc
ttcccctacgtagccctcgccccggacggcggcatcgatctggccccctacccccgggtg
cgggactggatcgggcggatcaaggcgctgccgggctacgtgcccatgaagggcctggag
gcctga

DBGET integrated database retrieval system