KEGG   Cyanobium gracile: Cyagr_3282Help
Entry
Cyagr_3282        CDS       T02359                                 

Definition
magnesium chelatase ATPase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cgc  Cyanobium gracile
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cgc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyagr_3282
Enzymes [BR:cgc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cyagr_3282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3194589..3195674)
Genome map
AA seq 361 aa AA seqDB search
MTPTRKRRVFPFTAIVGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPA
IDVVAGDPYNSSPSDPDLQSSEVRQRAERGEQLPVEARQVPMVDLPLGATEDRLCGTIDI
EKALSEGVRAFEPGLLAKANRGLLYVDEVNLLDDHLVDVLLDSAASGWNTVEREGVSVRH
PARFVLIGSGNPEEGELRPQLLDRFGMSVEVRTVRDPELRVQVVDQRTSFDADPDSFSDR
LQTAQEALQARVVEAQERLPQVAIDDDLRIRISAVCGELDVDGLRGDIVTNRAARALAAF
EGHQEVSDDDVARVVACCLRHRLRKDPLEQIDSGERVVKTFCKVFDRPAGDPSAFQLALA
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccaaccaggaagcgcagggtcttccccttcaccgccatcgtcgggcaggaggag
atgaagctggcgctgctgctcaacgtgatcgatccccgcatcggcggggtgatgatcatg
ggcgaccggggcacgggcaaatccaccaccatccgggccctcgccgatctgctgccggcg
atcgacgtggtggccggcgacccctacaacagctcgccgagcgaccccgacctgcagagc
agcgaggtgcgccagcgggccgaacggggcgaacagctgccggtggaggcccgccaggtg
ccgatggtcgacctgcccctcggcgctaccgaagaccgcctctgcggcacgatcgacatc
gagaaggccctcagcgagggcgtgcgcgccttcgagccggggctgctggccaaggccaac
cggggcctgctctacgtggatgaggtgaacctgctcgacgaccacctggtggacgtgctg
ctggattcggccgcctcgggctggaacacggtggagcgggagggcgtctcggtgcggcac
ccggcccgcttcgtgctgatcggctccggcaacccggaggagggggaactgcgcccccag
ctgctggatcgcttcggcatgagcgtggaggtgcgcaccgtgcgcgatccggagctgcgg
gtgcaggtggtggaccagcgcaccagcttcgatgccgaccccgacagcttcagcgaccgg
ctgcagaccgcccaggaagccctgcaggcccgggtggtggaggcccaggagcggctgccc
caggtggccatcgacgacgatctgcgcatccgcatctcggcggtctgcggcgaactggac
gtggacggcctgcggggcgacatcgtcaccaaccgggccgcccgggccctggcggccttc
gagggccatcaggaggtgagcgacgacgacgtggcccgggtggtggcctgctgcctgcgc
caccggctgcgcaaggaccccctcgagcagatcgactccggcgagcgggtggtgaagacg
ttctgcaaggtgttcgaccgccccgccggcgacccctccgccttccagctggccctggcg
gggtga

DBGET integrated database retrieval system