KEGG   Cricetulus griseus (Chinese hamster): 100689191Help
Entry
100689191         CDS       T02813                                 

Gene name
Lpl
Definition
lipoprotein lipase
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100689191 (Lpl)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100689191 (Lpl)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100689191 (Lpl)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100689191 (Lpl)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100689191 (Lpl)
  Exosomal proteins of breast milk
   100689191 (Lpl)
Heparan sulfate/heparin binding proteins [BR:cge00536]
 Enzymes (General comment) Variety
  100689191 (Lpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 473 aa AA seqDB search
MESKALLLVALGVWLQSLTASQGXAAADGGRDFTDIESKFALRTPDDTAEDNCHLIPGIA
ESVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQHY
PVSAGYTKLVGNDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRITG
LDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQP
GCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGL
CLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDKQLNQA
FEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMMKLKWKSDSYFSWSDWW
SSPGFVIEKIRVKAGETQKKVIFCAREKVSHLQKGKDSAVFVKCHDKSLKKSG
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctggtggctctgggagtgtggctccagagtttgaccgcc
tcccaaggantggccgcagcagacgggggaagagattttacagacattgaaagtaaattt
gccctaaggacccctgatgacacggctgaggacaattgccacctcattcccggaatagca
gaatctgtgtctaactgccacttcaaccacagcagcaagaccttcgttgtgatccatggc
tggacggtgacaggaatgtatgagagttgggtgcccaaacttgtggctgccctgtacaag
agagaacctgactccaacgtcattgtggtggactggctgtatcgggcccagcaacactat
ccagtgtcggctggctacaccaagctggtgggaaatgatgtggccaggttcatcaactgg
atggaggaagagtttaactaccccctggacaatgtccacctcttggggtatagccttgga
gctcatgctgctggtgtggcaggaagtctgaccaacaagaaggttaacagaatcactggc
ttggatccagctgggcctaactttgagtatgcagaggcccccagtcgcctttctcctgat
gatgcagatttcgtagacgtcttacatacattcaccagagggtcacctggccgaagtatt
gggatccagaaaccagtaggacatgttgacatttatcccaatggaggcactttccagcca
ggatgcaacattggggaagccattcgtgtgattgcagagcggggccttggagatgtggac
cagctggtaaagtgctcccatgagcgatccattcatctcttcattgactccttgctgaat
gaggaaaaccccagcaaggcttacaggtgcaactccaaggaagcctttgagaaagggctc
tgcctgagctgcagaaagaatcgatgcaacaatgtgggctatgagatcaacaaggtcaga
gccaaaaggagcagcaagatgtacctgaagactcgctctcagatgccctacaaagtcttc
cactaccaagtcaaaattcacttttctgggactgagagtgacaagcagctcaaccaggcc
tttgagatttctctgtatggcacagtggccgagagtgagaatatccccttcactctgcct
gaggtctccacaaataaaacctactccttcctgatttatacggaggtggacatcggagaa
ctgctgatgatgaagctcaagtggaagagtgattcctacttcagctggtcggactggtgg
agcagccccggctttgtcatcgagaagattcgggtgaaagcaggagagactcagaaaaag
gtcatcttctgtgctagggagaaagtgtctcatctgcagaagggaaaggactccgcagtg
tttgtgaagtgccatgacaagtctctgaagaagtctggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system