KEGG   Cricetulus griseus (Chinese hamster): 100689191Help
Entry
100689191         CDS       T02813                                 

Gene name
Lpl
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00561  Glycerolipid metabolism
cge01100  Metabolic pathways
cge03320  PPAR signaling pathway
cge04979  Cholesterol metabolism
cge05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100689191 (Lpl)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100689191 (Lpl)
  Digestive system
   04979 Cholesterol metabolism
    100689191 (Lpl)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100689191 (Lpl)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     100689191 (Lpl)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100689191 (Lpl)
  Exosomal proteins of breast milk
   100689191 (Lpl)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   100689191 (Lpl)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Enzymes
  100689191 (Lpl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_1 Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 100689191
NCBI-ProteinID: XP_003499976
Position
Un
AA seq 473 aa AA seqDB search
MESKALLLVALGVWLQSLTASQGXAAADGGRDFTDIESKFALRTPDDTAEDNCHLIPGIA
ESVSNCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQHY
PVSAGYTKLVGNDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRITG
LDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQP
GCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEKGL
CLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDKQLNQA
FEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMMKLKWKSDSYFSWSDWW
SSPGFVIEKIRVKAGETQKKVIFCAREKVSHLQKGKDSAVFVKCHDKSLKKSG
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcctggtggctctgggagtgtggctccagagtttgaccgcc
tcccaaggantggccgcagcagacgggggaagagattttacagacattgaaagtaaattt
gccctaaggacccctgatgacacggctgaggacaattgccacctcattcccggaatagca
gaatctgtgtctaactgccacttcaaccacagcagcaagaccttcgttgtgatccatggc
tggacggtgacaggaatgtatgagagttgggtgcccaaacttgtggctgccctgtacaag
agagaacctgactccaacgtcattgtggtggactggctgtatcgggcccagcaacactat
ccagtgtcggctggctacaccaagctggtgggaaatgatgtggccaggttcatcaactgg
atggaggaagagtttaactaccccctggacaatgtccacctcttggggtatagccttgga
gctcatgctgctggtgtggcaggaagtctgaccaacaagaaggttaacagaatcactggc
ttggatccagctgggcctaactttgagtatgcagaggcccccagtcgcctttctcctgat
gatgcagatttcgtagacgtcttacatacattcaccagagggtcacctggccgaagtatt
gggatccagaaaccagtaggacatgttgacatttatcccaatggaggcactttccagcca
ggatgcaacattggggaagccattcgtgtgattgcagagcggggccttggagatgtggac
cagctggtaaagtgctcccatgagcgatccattcatctcttcattgactccttgctgaat
gaggaaaaccccagcaaggcttacaggtgcaactccaaggaagcctttgagaaagggctc
tgcctgagctgcagaaagaatcgatgcaacaatgtgggctatgagatcaacaaggtcaga
gccaaaaggagcagcaagatgtacctgaagactcgctctcagatgccctacaaagtcttc
cactaccaagtcaaaattcacttttctgggactgagagtgacaagcagctcaaccaggcc
tttgagatttctctgtatggcacagtggccgagagtgagaatatccccttcactctgcct
gaggtctccacaaataaaacctactccttcctgatttatacggaggtggacatcggagaa
ctgctgatgatgaagctcaagtggaagagtgattcctacttcagctggtcggactggtgg
agcagccccggctttgtcatcgagaagattcgggtgaaagcaggagagactcagaaaaag
gtcatcttctgtgctagggagaaagtgtctcatctgcagaagggaaaggactccgcagtg
tttgtgaagtgccatgacaagtctctgaagaagtctggctga

DBGET integrated database retrieval system