KEGG   Cricetulus griseus (Chinese hamster): 100689241Help
Entry
100689241         CDS       T02813                                 

Gene name
Por
Definition
P450 (cytochrome) oxidoreductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cge  Cricetulus griseus (Chinese hamster)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 667 aa AA seqDB search
MTEAVAEEVSLFSTTDVVLFSLIVGVLTYWFIFRKKKEEVPEFSKIQTATPSVKESSFVE
KMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDKS
LVVFCMATYGEGDPTDNAQDFYDWLQETDVDLTGVKFAVFGLGNKTYEHFNAMGKYVDQR
LEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEFFGVEATGEESSIRQYELLVHE
DIDAAKVYTGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHLMHLELDISDSK
IRYESGDHVAVYPANDSTLVNQIGEILGADLDVVMSLNNLDEESNKKHPFPCPTTYRTAL
TYYLDITNPPRTNVLYELAQYASEPSEQEQLHKMASSSGEGKELYLSWVVEARRHILAIL
QDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYEAKSGRVNKGVAT
SWLRAKEPAGENGRRALVPMFVRKSQFRLPFKSVTPVIMVGPGTGIAPFMGFIQERAWLR
EQGKEVGETLLYYGCRRSDEDYLYREELARFHKDGALTQLNVAFSREQAHKVYVQHLLKR
DREHLWKLIHEGGAHIYVCGDARNMAKDVQNTFYDIVAEFGPMEHAQAVDYVKKLMTKGR
YSLDVWS
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggctgtagcagaagaagtgtctcttttcagcacaacggacgtggttctgttt
tctctgattgtgggggtcctgacctactggttcatctttaggaagaagaaagaagaggtg
ccagagttcagcaagatccaaacagcgaccccatcagtcaaagagagcagcttcgtggag
aagatgaagaaaacgggaaggaacattatcgtattctatggctcccagacggggactgct
gaggagtttgccaaccgcctgtccaaggatgcccaccgctatgggatgcggggcatgtct
gcagaccccgaagagtatgacttggccgacctgagcagcttgcctgagatcgacaagtcc
ctggtagtcttctgcatggccacgtatggcgagggtgaccccaccgacaacgcccaggac
ttctatgactggctgcaggagactgatgtggacctcactggggtcaagtttgctgtgttc
ggccttgggaacaagacctatgagcatttcaatgccatgggcaagtatgtggaccagcga
ctggagcagctcggcgcccagcgcatctttgagttgggccttggtgatgacgatgggaac
ttggaagaggatttcatcacatggagggagcagttctggccagccgtgtgcgagttcttc
ggggtggaagccactggggaggagtccagcattcgtcagtatgagctcttggtccacgaa
gacattgatgctgccaaggtttacaccggcgagatgggccgcctgaagagctatgagaac
cagaaacccccctttgatgccaagaacccattcctggctgctgtcaccactaaccggaaa
ctgaaccagggcactgagcggcacctgatgcacttggaattggacatctcagactcgaag
atcaggtatgaatctggggatcatgtggctgtgtacccggccaatgactccaccctggtc
aaccagatcggggagatcctaggggctgacttggatgtcgtcatgtctctaaacaatctc
gatgaggagtccaacaagaagcacccgttcccctgccccaccacctaccgcacggccctc
acctactacctggacatcaccaacccgccgcgtaccaacgtgctctacgagctggcgcag
tatgcctcagagccctctgagcaggagcagctgcacaagatggcgtcatcctcaggcgag
ggcaaggagctgtacctgagctgggtggtggaggcccggaggcacatcttagccattctc
caagactacccctcactgcggccacccatcgaccacctgtgtgagctgctacctcggctg
caggcccgctactactccatcgcctcctcctctaaggtccaccccaactcggtgcacatc
tgcgctgtggctgtggagtatgaggccaagtctggacgagtgaacaagggcgtggccacc
agctggcttcgggccaaggagccagcaggagagaacggccgccgggccctggtgcccatg
ttcgtgcgcaaatctcagttccgcctccctttcaagtccgtcacacctgtcatcatggtg
ggtcctggcacagggatcgcccccttcatgggcttcatccaggagcgagcctggcttcgg
gagcaaggcaaggaggttggagagacactgctatactatggctgccggcgctcggatgag
gactacctataccgcgaagagctggcccgctttcacaaggacggggccctcacccagctt
aatgtggccttttccagggagcaggcccacaaggtctatgtccagcacctgctgaagaga
gacagagagcacctgtggaagctcatccacgagggcggggcccacatctacgtctgcggg
gatgctcgaaacatggccaaagacgtgcagaacaccttctacgacatcgtggccgagttt
gggcccatggagcacgcccaggctgtggactatgttaagaagctgatgaccaagggtcgc
tactccctggacgtgtggagctag

DBGET integrated database retrieval system