KEGG   Cricetulus griseus (Chinese hamster): 100689289Help
Entry
100689289         CDS       T02813                                 

Gene name
Ear11
Definition
eosinophil-associated, ribonuclease A family, member 11 (EC:3.1.27.5)
Organism
cge  Cricetulus griseus (Chinese hamster)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 158 aa AA seqDB search
MGPKLLESRLCLLLLLGFVIMVASFQIPPGLTPSQWFEIQHVNNRTNLRCNPAMRIVNGY
TRRCKNINTFLNTSFPAVARVCGRPNTNCTRSPGTNCHNSSAQVSLTYCNLTNPGSHYTQ
CQYQMTPARKFYRVACNNRTPQDNGSYAVVPVHLDGTF
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgggtccgaagctgcttgagtcccgactttgtctcctgctgctgctgggatttgtcata
atggttgcctctttccagatcccaccgggtttaaccccttcccagtggtttgaaattcag
catgtaaataataggaccaacctccgatgtaatcctgcaatgaggatagttaacggttac
acaagacgatgcaagaacataaatacttttcttaatacaagttttcctgctgtcgctcgt
gtgtgtggcagaccaaatactaattgcactaggagtcctggtacaaattgtcataacagt
tcagctcaagtatctttaacatactgtaaccttacaaatccaggaagtcattatacacaa
tgccaataccaaatgactccagcaaggaagttctacagagtggcttgtaacaatcgtacc
ccacaagacaatggttcctatgcagtggttccagttcacttggatgggacattttag

DBGET integrated database retrieval system