KEGG   Cricetulus griseus (Chinese hamster): 100689290Help
Entry
100689290         CDS       T02813                                 

Gene name
Ear15
Definition
eosinophil-associated ribonuclease 15
Organism
cge  Cricetulus griseus (Chinese hamster)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 158 aa AA seqDB search
MGPKLLESRLCLPLLLGFVIMVASFQIPPGLTPSQWFEIQHVNNRTNLRCNPEMRVVNGY
TRRCKNINTFLNTSFAAVARVCGRPNTNCTRSPGTNCHNSSAQVSLTYCNLTNPGSHYTQ
CQYQMTPARKFYRVACNNRTPQDNGSYAVVPVHLDGTF
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgggtccgaagctgcttgagtcccgactttgtctcccgctgctgctgggatttgtcata
atggttgcctctttccagatcccaccgggtttaaccccttcccagtggtttgaaattcag
catgtaaataatagaaccaatctccgatgcaatcctgaaatgagggtagttaacggatac
acaagacgatgcaagaacataaatacttttcttaatacaagttttgctgctgtcgctcgt
gtgtgtggcagaccaaatactaattgcactaggagtcctggtacaaattgtcataacagt
tcagctcaagtatctttaacatactgtaaccttacaaatccaggaagtcattatacacaa
tgccaataccaaatgactccagcaaggaagttctacagagtggcttgtaacaatcgtacc
ccacaagacaatggttcctatgcagtggttccagttcacttggatgggacattttag

DBGET integrated database retrieval system