KEGG   Cricetulus griseus (Chinese hamster): 100689290Help
Entry
100689290         CDS       T02813                                 

Gene name
Ear15
Definition
eosinophil-associated ribonuclease 15
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     100689290 (Ear15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 158 aa AA seqDB search
MGPKLLESRLCLPLLLGFVIMVASFQIPPGLTPSQWFEIQHVNNRTNLRCNPEMRVVNGY
TRRCKNINTFLNTSFAAVARVCGRPNTNCTRSPGTNCHNSSAQVSLTYCNLTNPGSHYTQ
CQYQMTPARKFYRVACNNRTPQDNGSYAVVPVHLDGTF
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgggtccgaagctgcttgagtcccgactttgtctcccgctgctgctgggatttgtcata
atggttgcctctttccagatcccaccgggtttaaccccttcccagtggtttgaaattcag
catgtaaataatagaaccaatctccgatgcaatcctgaaatgagggtagttaacggatac
acaagacgatgcaagaacataaatacttttcttaatacaagttttgctgctgtcgctcgt
gtgtgtggcagaccaaatactaattgcactaggagtcctggtacaaattgtcataacagt
tcagctcaagtatctttaacatactgtaaccttacaaatccaggaagtcattatacacaa
tgccaataccaaatgactccagcaaggaagttctacagagtggcttgtaacaatcgtacc
ccacaagacaatggttcctatgcagtggttccagttcacttggatgggacattttag

DBGET integrated database retrieval system