KEGG   Cricetulus griseus (Chinese hamster): 100689291Help
Entry
100689291         CDS       T02813                                 

Gene name
Ear7
Definition
(RefSeq) eosinophil-associated, ribonuclease A family, member 7
Organism
cge  Cricetulus griseus (Chinese hamster)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 157 aa AA seqDB search
MGPKLLESRLCLLLLLGFFIMVASFQIPRNLTPSQWFEIQHVNNSTILQCTPAMKGVNNY
TGRCKNINTFLNTSFAAVVSVCGNKNTTCRNGHTNCHNSSAPVSLTYCNLTTWSSNYTQC
RYQTTPATKFYRIACDNRKPQDSPNYPVVPVHLDGTF
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgggtccgaagctgcttgagtcccgactttgtctcctgctgctgctgggatttttcata
atggttgcctctttccagatcccacgtaatttaaccccttcccagtggtttgaaatccaa
catgtaaataatagtaccatcctccaatgtactcctgcaatgaagggagtcaacaattac
acaggacgatgcaagaacataaatacttttcttaatacaagttttgctgctgttgttagt
gtgtgtggcaataaaaatactacttgccgcaatggccacacaaattgccataatagttca
gctccggtatctttaacttactgtaacctcacaacttggtcaagcaattatacacaatgt
cgataccaaacgacaccagcaacaaagttctacagaattgcttgtgacaatagaaagcca
caggacagtcctaactatccagtggttccggttcacttggatgggacattttag

DBGET integrated database retrieval system