KEGG   Cricetulus griseus (Chinese hamster): 100689389Help
Entry
100689389         CDS       T02813                                 

Gene name
St6gal1, St6gal
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 (EC:2.4.99.1)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100689389 (St6gal1)
   00514 Other types of O-glycan biosynthesis
    100689389 (St6gal1)
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100689389 (St6gal1)
Glycosyltransferases [BR:cge01003]
 Terminal extension
  Sialyltransferase
   100689389 (St6gal1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 402 aa AA seqDB search
MIHTNLKKKFSYFILAFLLFALICVWKKGSYEALKLQAKEFQVTRSLEKLAMRSGSQSMS
SSSKQDPKQDSQVLSHARVTAKVKPQPSYQVWDKNSSSKNLNPRLQKILKNYLNMNKYKV
SYKGPGPGVKFSAEALRCRLRDRVNVSMIEATDFPFNTTEWAGYLPKENIRTKAGPWHRC
AVVSSAGSLKSSQLGREIDNHDAVLRFNGAPVANFQQDVGTKTTIRLMNSQLITTEKQFL
KDSLYSEGILIVWDPSLYHADIPSWYQKPDYNFFETYKSYRKLYPDQPFYILRPQMPWEL
WDIIQEIAPDRIQPNPPSSGMLGIMIMMTLCDQVDIYEFLPSRRKTDVCYYHQKFFDSAC
TMGAYHPLLFEKNMVKQLNEGTDEDIYIFGKATLSGFRTIHC
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgattcacaccaacctgaagaaaaagttcagctacttcatcctggcctttctcctgttt
gcactcatctgtgtgtggaagaaagggagctatgaggctcttaaattgcaagccaaggaa
tttcaggtgaccaggagcctggagaagctggccatgcggtctggttcccagtccatgtct
tcaagcagcaaacaagaccctaagcaggacagtcaagttctcagtcatgccagggtcaca
gccaaggtcaaaccacagccctcctaccaggtgtgggacaagaactcctcatccaaaaac
ctcaaccccaggctgcaaaagatcctgaaaaactatctgaacatgaacaaatataaagtg
tcctacaaggggccagggccaggagtcaagttcagtgctgaggccctgcgctgccgcctt
cgagaccgtgtgaacgtatccatgatagaggccacagattttcccttcaacactactgaa
tgggcgggttacctgcctaaggagaacattaggaccaaggctgggccatggcacaggtgt
gccgtcgtctcctccgcaggatctctgaaatcctctcagctgggcagagagattgataat
catgatgcagtcctgaggtttaatggggcaccagtagccaacttccaacaggatgtgggc
acgaaaacaaccattcgcctgatgaattctcagttaatcaccacagaaaagcagttcctt
aaggacagcttatacagtgaaggaatcctaattgtgtgggacccatccttgtaccatgca
gatatcccaagctggtaccagaagccagactacaatttcttcgaaacgtataagagttat
cgcaagctgtatcccgaccagcccttttatatcctcaggccgcagatgccatgggaactg
tgggacatcattcaggaaattgctccagacaggattcagccaaatcccccatcctctggc
atgctgggtatcatgatcatgatgacactgtgtgaccaggtagatatttatgagttcctc
ccgtccaggcgcaagactgacgtgtgctattaccaccagaagttcttcgacagtgcctgc
acgatgggtgcataccacccgctgctcttcgagaagaatatggtgaagcaactcaacgag
ggcacagatgaagacatttacatttttgggaaagccacgctgtccggcttccggaccatt
cactgctaa

DBGET integrated database retrieval system