KEGG   Cricetulus griseus (Chinese hamster): 100750548Help
Entry
100750548         CDS       T02813                                 

Definition
lysozyme C-1
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:cge00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    100750548
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100750548
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100750548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 148 aa AA seqDB search
MKAFLTLGFLLLSVTVQAKVYSRCEFARILKRHGMDGYRGISLANWVCLAQHESGFNTKA
TNYNPGPRSTDYGIFQINSKYWCNNGKTPGAVNACGIPCSVLLQDDITQAIQCAKRVVRD
PQGIRAWVAWRSYCQNRNLSQYVRGCRL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctttcctcaccctggggttcctcttgctttctgtcactgtccaggccaaggtt
tacagtcgatgcgagttcgccagaattctgaaaagacatggaatggatggctacagggga
atcagtctggcaaactgggtgtgtttggctcagcatgagagtggctttaacacaaaagct
acaaactacaaccctggacccagaagcacagactatgggatatttcagatcaatagcaaa
tactggtgtaataatggcaaaaccccaggagcagtgaatgcctgtgggataccctgcagc
gtgttgctccaggatgacatcactcaagccatacaatgtgcaaagagggttgtgagggat
ccacaaggcattagagcatgggtggcatggagaagctactgtcaaaaccgaaatctcagc
cagtatgttcggggctgtagactctaa

DBGET integrated database retrieval system