KEGG   Cricetulus griseus (Chinese hamster): 100750593Help
Entry
100750593         CDS       T02813                                 

Definition
(RefSeq) acyl-CoA desaturase 1
  KO
K00507  
stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100750593
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100750593
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100750593
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100750593
Lipid biosynthesis proteins [BR:cge01004]
 Desaturase
  First
   100750593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
3
AA seq 412 aa AA seqDB search
MPAHMLQEVSVQKRPPPRASATRTGLLANWCEESGTPPTVEGSTPCCPHASAVLILHSLS
WQISGSYSTTTTITAPPSGGQQNGGEKLEKNPHHWGADVRPELKDDLYDPSYQDEEGAPP
KLEYVWRNIILMALLHLGALYGITLVPSCKIYTCLFGIMYYVISALGITAGAHRLWSHRT
YKARLPLRVFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLV
RKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKSGLLLMCFILPTLVPWYCWGETFLNSLF
VSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIESRENILVSLGAVGEGFHNYHHAFPYD
YSASEYRWHINFTTFFIDCMAALGLAYDRKRVSKAAVLARIKRTGDGSRKSS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccacatgctccaagaggtgagcgtgcagaagcggcccccgccccgcgcgtcg
gccacgcggactgggcttctagctaactggtgtgaggaaagtggcaccccacccacagta
gagggaagtaccccttgctgcccccacgcgtctgcagtcctaattctccactccctctcc
tggcagatctctggctcttactcaaccaccaccacaatcacagcgcctccctctggggga
cagcagaatggaggagagaagttagaaaagaatcctcaccactggggagcagatgttcgc
cctgaattaaaagatgacttatatgaccccagctaccaggatgaggagggggccccgccc
aagctggagtacgtctggagaaacatcatcctcatggccctgctgcacttgggggccctg
tatgggatcacactggttccgtcctgcaagatctacacctgcctcttcgggattatgtac
tatgtcatcagtgccttgggcatcaccgccggggcgcaccgcctgtggagccaccgaact
tacaaggctcggctgcccctgagggtcttcctcatcattgccaacaccatggcttttcag
aatgacgtgtatgaatgggcccgagaccaccgcgcgcaccacaaattctcagaaacacac
gctgaccctcacaattcccgccgtggctttttcttctctcacgtgggctggctgcttgtg
cgcaaacacccggctgtcaaagagaagggcggaaaactggacatgtctgacctaaaagcc
gagaagctggtcatgttccagaggaggtactacaagtccggtctcctattgatgtgtttc
atcctgcccacactggtgccctggtattgctggggtgaaactttcctgaacagcttgttt
gttagcaccttcttgcgatacactttggtgctcaatgccacctggctggtgaacagcgcc
gcccacctctatggatatcgtccgtacgacaagaacattgaatctcgagagaatatcctg
gtttccctaggtgcagtgggcgagggcttccacaactaccaccacgccttcccctatgac
tactcggccagtgagtaccgctggcacatcaacttcaccacgttcttcatcgactgcatg
gctgccctgggcctggcttatgaccggaagagagtgtctaaggctgctgtcttggccagg
attaaaagaactggagacgggagccgtaagagtagctga

DBGET integrated database retrieval system