KEGG   Cricetulus griseus (Chinese hamster): 100750593Help
Entry
100750593         CDS       T02813                                 

Definition
acyl-CoA desaturase 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100750593
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100750593
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100750593
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100750593
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100750593
Lipid biosynthesis proteins [BR:cge01004]
 Desaturase
  First
   100750593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 380 aa AA seqDB search
MPAHMLQEVSVQKRPPPRASATRTGLLANWISGSYSTTTTITAPPSGGQQNGGEKLEKNP
HHWGADVRPELKDDLYDPSYQDEEGAPPKLEYVWRNIILMALLHLGALYGITLVPSCKIY
TCLFGIMYYVISALGITAGAHRLWSHRTYKARLPLRVFLIIANTMAFQNDVYEWARDHRA
HHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYK
SGLLLMCFILPTLVPWYCWGETFLNSLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKN
IESRENILVSLGAVGEGFHNYHHAFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKRV
SKAAVLARIKRTGDGSRKSS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccacatgctccaagaggtgagcgtgcagaagcggcccccgccccgcgcgtcg
gccacgcggactgggcttctagctaactggatctctggctcttactcaaccaccaccaca
atcacagcgcctccctctgggggacagcagaatggaggagagaagttagaaaagaatcct
caccactggggagcagatgttcgccctgaattaaaagatgacttatatgaccccagctac
caggatgaggagggggccccgcccaagctggagtacgtctggagaaacatcatcctcatg
gccctgctgcacttgggggccctgtatgggatcacactggttccgtcctgcaagatctac
acctgcctcttcgggattatgtactatgtcatcagtgccttgggcatcaccgccggggcg
caccgcctgtggagccaccgaacttacaaggctcggctgcccctgagggtcttcctcatc
attgccaacaccatggcttttcagaatgacgtgtatgaatgggcccgagaccaccgcgcg
caccacaaattctcagaaacacacgctgaccctcacaattcccgccgtggctttttcttc
tctcacgtgggctggctgcttgtgcgcaaacacccggctgtcaaagagaagggcggaaaa
ctggacatgtctgacctaaaagccgagaagctggtcatgttccagaggaggtactacaag
tccggtctcctattgatgtgtttcatcctgcccacactggtgccctggtattgctggggt
gaaactttcctgaacagcttgtttgttagcaccttcttgcgatacactttggtgctcaat
gccacctggctggtgaacagcgccgcccacctctatggatatcgtccgtacgacaagaac
attgaatctcgagagaatatcctggtttccctaggtgcagtgggcgagggcttccacaac
taccaccacgccttcccctatgactactcggccagtgagtaccgctggcacatcaacttc
accacgttcttcatcgactgcatggctgccctgggcctggcttatgaccggaagagagtg
tctaaggctgctgtcttggccaggattaaaagaactggagacgggagccgtaagagtagc
tga

DBGET integrated database retrieval system