KEGG   Cricetulus griseus (Chinese hamster): 100751196Help
Entry
100751196         CDS       T02813                                 

Gene name
Akp3
Definition
intestinal-type alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100751196 (Akp3)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100751196 (Akp3)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100751196 (Akp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 559 aa AA seqDB search
MQGACLLLLLGLQLQLSLSVIPVEEENPAFWNQKAAEALNVAKKLQPIQTSAKNLIIFLG
DGMGVPTVTATRILKGQLEGHLGPETPLAMDSFPYMALSKTYSVDRQVPDSASTATAYLC
GVKTNYKTIGVSAAARFDQCNTTFGNEVISVMYRAKQAGKSVGVVTTTRVQHASPAGTYV
HTVNRNWYGDADMPASALQEGCKDIATQLISNMDINVILGGGRKYMFPAGTPDPEYPNDV
NQTGTRLDGRNLVQEWLSKHQGSQYVWNREELIQKSLDPSVTYLMGLFEPVDTKFEIQRD
PLMDPSLKDMTEAALRVLSRNPKGFYLFVEGGRIDRGHHLGTAYLALTEAVMFDTAIEKA
SQLTSEKDTLTIVTADHSHVFSFGGYTLRGTSIFGLAPLKALDGKSYTSILYGNGPGYVG
TGERPNVTAAESRDPSYQQQAAVPVKSETHGGEDVAIFARGPQAHLLHGVQEENYIAHVM
AFAGCLEPYTNCGLAPPADDSSATAPGQTSTTTRQTTTTSQTTTPVQSSAGSLGPATTPL
PLTLLAGTLLLLLGAAAES
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcagggagcctgtctgctgctgctgctgggtctccagctacagctgtcacttagtgtc
atcccagtggaggaggagaacccagccttctggaaccaaaaggcagccgaggccctgaat
gttgccaagaagctgcagcccattcagacatcagccaagaacctcatcatcttcctgggg
gatggaatgggggtgcccacagtaacagcaactcggatcctaaagggacaactggaaggt
catctaggacctgagacacccctagccatggacagcttcccatacatggctctgtccaag
acatacagtgtggacagacaagtcccagacagcgcaagcacagccacagcctacctgtgc
ggggtcaagaccaactacaagaccattggtgtgagtgcagctgctcggtttgaccagtgc
aacaccacatttggcaacgaggtcatctcagtgatgtatcgtgccaagcaagcaggaaaa
tctgtgggagtggtgaccaccaccagggtgcagcacgcctctccggcgggcacctatgtt
cacacggtgaaccgtaactggtatggggatgctgatatgccggcctcagcactacaggag
ggctgcaaggacattgccacacaactcatctccaacatggacattaacgtgatccttggt
gggggtcgaaaatacatgtttcctgcaggaaccccagaccctgagtatccaaacgatgtt
aaccagaccggaactaggcttgatggccggaacctggtgcaggaatggctgtcgaagcac
cagggatcccagtatgtttggaaccgtgaagaactcatccagaagtccctggatccatca
gtgacatacctcatgggcctctttgagcctgtagacacaaaattcgagatacaacgagac
cccttgatggatccatctctgaaggacatgacagaggcagccctgagggtgctgagcagg
aaccccaaaggcttctacctctttgtggaggggggccgaatcgaccgtggtcaccatctg
ggcacagcttatctggcgctgactgaggctgtcatgttcgacacagccatcgagaaggcc
agccagctcaccagcgagaaggacacactgaccatagtcaccgctgatcactcccatgtc
ttctcctttggtggctatacacttcggggcacctccatcttcgggctggcacccctcaaa
gctctggatggcaagtcctacacctccatcctgtacggcaacggcccaggctacgttggt
acaggcgaaagacccaacgtcaccgccgctgaaagccgtgacccctcgtaccagcaacag
gcggctgtgccggtgaagtcggagacccacggcggggaggacgtggcgatatttgcgcgt
ggcccgcaggcacacctgctgcacggagtgcaggaggagaactacatcgcccacgtcatg
gcctttgcaggctgcctggagccctacaccaactgcggtctggcgccccctgcggacgac
agcagtgcaacagccccgggccagacctccacgacaaccagacagaccaccaccaccagc
cagaccaccacccctgtccagagcagcgccggtagcctaggcccagccaccaccccgctg
cccctgactctgctggccggaaccctgctgctgctgctgggagctgctgcagagtcctaa

DBGET integrated database retrieval system