KEGG   Cricetulus griseus (Chinese hamster): 100751325Help
Entry
100751325         CDS       T02813                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2B4
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00040  Pentose and glucuronate interconversions
cge00053  Ascorbate and aldarate metabolism
cge00140  Steroid hormone biosynthesis
cge00830  Retinol metabolism
cge00860  Porphyrin and chlorophyll metabolism
cge00980  Metabolism of xenobiotics by cytochrome P450
cge00982  Drug metabolism - cytochrome P450
cge00983  Drug metabolism - other enzymes
cge01100  Metabolic pathways
cge05204  Chemical carcinogenesis
Module
cge_M00014  Glucuronate pathway (uronate pathway)
cge_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100751325
   00053 Ascorbate and aldarate metabolism
    100751325
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100751325
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100751325
   00860 Porphyrin and chlorophyll metabolism
    100751325
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100751325
   00982 Drug metabolism - cytochrome P450
    100751325
   00983 Drug metabolism - other enzymes
    100751325
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100751325
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100751325
Glycosyltransferases [BR:cge01003]
 Others
  Hydrophobic molecule
   100751325
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_4_2 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 100751325
NCBI-ProteinID: XP_003513968
Position
Un
AA seq 530 aa AA seqDB search
MSVKMTAALLLLQLSGFFGSGSSGKVLVWPMEYSHWLNLKTILDELVKKGHEVTVLIPSA
SLSYEVEDTSAIEFETYPSSFSMTDLEELYMESIRKSIYELPKLSFWRYLLMYQELVWVD
SDYFESLCKDVVFNKELMKKLQTSSFDVILADPFIPCGDLLAEILKIPLVFSLRFFYGST
YEKYSGGLPLPPSYVPPALSELSDQMTFMERVQNVLYVLCFDFWFQTFNEKKWNQLYTEV
LGRPTTLLEMMGKADIWLIRTYWDLEFPHPVLPNFDFVGGLHCRPAKPLPKEIEDFVQSS
GEHGVVVFSLGSMVGNLTEERANVIAAGLAQIPQKVLWRFEGKKPDTLGSNTRLYKWIPQ
NDLLGHPKTRAFITHGGTNGIYEAIYHGIPVVGIPLFADQFDNVVHMKTKGAGVRLDFLT
MSSTDLLNAVKTVTTDPFYKENAMRLSRIHHDQPVKPLDRAVFWVEYVMRNKGAKHLRVA
AHDLTWFQYHSLDVLGFLLACVVTVIFIITKCCLFCCQKFVKGGKKKKRE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaaatgacagcagccctgctcctgctacaactgagtggcttctttggatct
ggaagtagtgggaaggtgctggtgtggccaatggaatacagccattggctcaacttaaag
acaatcctagatgagcttgtgaagaagggtcatgaagtgactgttctgataccctcagct
tctctttcttatgaggttgaggacacatctgctattgagtttgagacatacccttcatca
ttttccatgactgatttggaggaactttacatggaatcaatcaggaaaagcatttatgag
ctgccaaagctatcattttggagatacttgttaatgtatcaagaactggtttgggtagat
tcagattattttgaaagtctctgcaaagatgtagttttcaacaaggaactcatgaaaaaa
ctacaaacttcaagctttgatgtcatcctggcagatcccttcataccctgtggtgatctg
ctggctgagattctcaagataccactggtgttcagtctccgcttcttttatggctccaca
tatgaaaagtacagtggaggactcccactacctccttcctatgtgccacctgctctgtca
gaattgagtgatcagatgacgttcatggagagggtgcaaaatgtactctatgtgctttgt
tttgacttctggttccaaacatttaatgagaagaagtggaatcagctttatactgaagta
ttaggaagacccacaacactcctggagatgatgggcaaggcagatatatggctcattcga
acctactgggatttggagtttcctcaccctgtcttaccaaattttgattttgttggagga
ctgcactgcagacctgccaagcctctacctaaggaaatagaggactttgtccagtcttct
ggagaacacggtgttgtggtgttttccctggggtccatggtgggtaacttaacagaagaa
agagccaatgtgattgcagcaggcctcgcccagattccacagaaggttctttggcgattt
gaaggcaagaaaccagacaccttgggatccaacactcggctgtacaaatggatcccccag
aatgaccttcttggtcatcctaaaaccagagcttttataactcatggtggcaccaatggc
atctatgaggcgatctaccacgggatccctgtggttggaattcctttgtttgcagaccaa
tttgataatgttgttcacatgaagaccaaaggagcaggtgttagactggactttctcaca
atgtccagtacagatttgctcaatgcagtgaagacagtcacaactgaccctttctataag
gagaatgccatgcggctatcaagaattcaccatgatcagccagtgaagcccctggacaga
gctgtcttctgggttgagtatgtcatgcgcaataaaggagccaagcaccttcgtgtggca
gcacatgacctcacctggttccagtaccactctctggatgtgcttggattcctgcttgcc
tgtgtggtgactgtgatcttcatcatcacaaagtgctgtctcttttgttgtcagaagttt
gttaaaggtggaaagaagaagaaaagggagtaa

DBGET integrated database retrieval system