KEGG   Cricetulus griseus (Chinese hamster): 100751361Help
Entry
100751361         CDS       T02813                                 

Gene name
Kat6a, Myst3
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:cge00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    100751361 (Kat6a)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100751361 (Kat6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1992 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDTKQSVDWNKLLKRAFEGLAESGGSTLKS
IERFLKSQKDVSAAYGGSAASGFHQQLRLAIKRAVGHGRLLKDGPLYRINTKAASADGKE
GCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSTELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYTNPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKIPISSQSASSSEEGYLERIDGLDFCRDSNVPLKFNKKTKGLIDGLTKFFTPSP
DGRKARGEVVDYSEQYRIRKKGNRKSSTSDWPTDNQDGWDSKQENEERLFGSQEIMTERD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTG
VCPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIV
SNSVVSEEEEEDADEGDREEPQGQERELETTVGKSLSRENKDQDSSSLIESEKKPEVKEL
SSSSRLSKQVLPRDSLPANSQPLRRGRCTRKNRKTQERFGDKDSKVLVDETSTPQEQYGE
CEEKSEASQEQYPEIEEHSAACQVQPDGKADIPKGRLSESVELWRGQLKKSPETLKCRVP
EGNDRLPCCYSDGDRAVFRGFSESSEEEEEPESPRSNSPPILTKPTLKRKKPILHRRRRV
RKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEDEDENELFPRG
YFHRLSSQDVLRCQSSSKRPSKDEEEEEESDDVDDTPILKPVSLLRKCDVNSASLEPDTS
TPMKKKKGWPKGKSRKPIHWKKRPGRKPGFKLNQEIIAVSTKECIIEPIVPIKPGRKPRT
QENEEMVEVKEDLPLLEERKEEMHTEADEEEEDTTSSDIRAMSPLDSSNSPEAEPKEPEA
DEEDEKPLEEQRQSEEEPQELEEQEQEEDDEVTAEANQNEDHDADDEDDGHLESLKTKEP
EEQPAREDHKEEPGIPESFLDANMQDSRENTKDKDETEPDSEEEQPSHEASVVSETMPGS
EEDHEEDSNTKEELIELKEEEEIPHSELDLETVQAVQSLTQEESSEHEGAYQDCEETLAA
CQTLQSYTHTDEDPQMSMVEDCHASEHNSPISSIPSHPSQSVRSVSSPSVPALESGYTQI
SPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDST
MGSSICGNNSSQSSCSYGGLSSSSSLTQNSCVVTQQMANIGNSCSMLQQNSVQPATNCNI
KSPQTCVVERPPSNQQPPPPPPPPPPPQQQQQQQQPAPQPPPPQPQQQQQPPPPQQQPQP
PPPPQQQPPLSQCSMNNSFTTAPMIMEIPESGSTGNISIYERIPGDFGAGSYSQPSATFS
LAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAPLAPSHPLAGAPQAQATMTP
PPNLASPTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKSAPLPSATAHQQ
QLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSMNMNTLNAMNSYRMTQPMM
NSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGV
PKQSLNGPYMRR
NT seq 5979 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgctaacccgttgtacacggaatggattttggaggccatcaaaaaagta
aagaagcagaaacagcgaccttcagaagaaaggatttgcaatgcagtgtcttcatcccat
ggcttggatcgtaaaactgttctagagcagttggagttgagtgttaaagatgggacaatt
ttaaaagtctcaaacaaaggtctcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaaacctcgaaaccatggaaaattggatactaaacaaagtgtggattggaat
aaattactcaaacgggcatttgagggcttggcagagtctggtggctcaactttgaaaagt
attgaacgctttttgaaaagccagaaggatgtgtctgctgcctatggaggcagtgctgcc
tctggctttcaccagcagttaagattggcgatcaagcgtgctgttggccatggcagactc
cttaaagatggacctctgtaccggatcaacactaaggcagccagtgctgatgggaaagag
ggttgtgagtccctctcttgtttacctccagtgtcactgcttccacatgagaaagataag
ccggttgctgaaccaatacccatctgtagtttctgtcttggtacaaaagaacaaaaccgg
gaaaagaagcctgaggaactcatctcctgtgctgactgtggcaatagtggtcatccatcc
tgtttaaagttttccacagaactaacagtgagagtgaaggccctacggtggcagtgcatt
gagtgtaaaacgtgcagctcttgtcgtgatcaaggcaaaaatgcagataacatgctcttt
tgtgattcatgtgaccgaggttttcacatggagtgttgtgatccaccactcacacggatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaaaggacgaaaacttcta
caaaagaaggcggcacagataaaacggcgctatactaatccaataggacgtccaaaaaac
aggttaaagaaacaaaacacggtatcaaaaggtccctttagcaaagtgcgaactggtcct
ggaaggggtcggaaacgtaaaatccctatctccagtcaatcagcatcatcatcagaagaa
ggatatttagagcgaatagatggcttggacttctgcagagatagcaatgtccccttgaag
ttcaacaagaaaaccaaagggctcattgatggccttaccaaattcttcaccccttctcct
gatgggcggaaagcccgtggggaggtggtagactactctgagcaatacagaatcaggaaa
aagggcaacagaaaatcaagcacttcagattggcccacagacaatcaggatggctgggat
agcaaacaagaaaatgaagagcggctttttgggagccaggaaatcatgacggagagagat
atggaattatttcgtgacatccaggagcaagcgctgcagaaagttggagtgactgggccc
cctgacccacaagtccgctgtccctctgtcattgagtttgggaaatatgaaattcacacc
tggtattcctcgccatatcctcaagaatactcgaggctgcctaaattgtatctttgtgag
ttctgtctaaaatatatgaaaagtagaactattctacagcagcacatgaagaaatgtggt
tggttccatcctcctgccaatgagatttaccgaaagaataatatttctgtctttgaggtt
gatgggaatgtgagtaccatttattgtcagaatctgtgtctcttggcaaagttgtttctt
gaccacaaaacactctattatgatgtggagccatttcttttctatgttctgacacagaat
gatgtcaagggctgccaccttgttggctacttttctaaagaaaagcactgccaacagaaa
tacaatgtctcttgtataatgattcttccccaataccaacgtaagggctacggcaggttt
ctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtcccctgagaaa
ccattgtcagatctaggtcgtctttcctacatggcttactggaaaagtgtaatactggag
tgcctttatcaccaaaacgataagcaaatcagcattaagaagctaagcaagctgactgga
gtctgtcctcaagacattacttccacactccaccaccttcgaatgctggacttccgcagt
gaccaatttgtgattatccgccgggaaaaacttatccaggatcacatggcaaagcttcaa
ctgaatcttcgacctgtagatgtagatccagaatgcttacgctggactccagtcatagtc
tccaactctgttgtctcagaggaggaagaagaggacgctgatgaaggagacagagaagag
ccccaaggccaagaaagagaattagagaccactgtgggaaagtctctgtctcgggagaac
aaagatcaagattcttcctctttaatagaaagtgaaaagaaaccagaagttaaggaactg
tccagttcttcaaggttgagcaaacaggttcttccccgggatagtcttcctgccaatagc
cagccgcttcggaggggccgctgtacaaggaagaacagaaagacccaggaacgttttggt
gataaagattccaaggtgcttgtggatgagacatcaactcctcaggaacaatatggagaa
tgtgaggaaaaatcagaagcctcccaagaacaataccctgaaatcgaagaacattcagca
gcctgtcaagtgcaaccagacgggaaagcagacattcccaaggggagactgagtgagagt
gttgagctgtggcgaggacagctgaagaaaagccctgagaccctgaagtgcagagtgcca
gaaggaaacgatagactgccgtgctgttacagtgatggtgacagagctgtctttagaggg
ttcagtgagagtagtgaggaggaagaagagccagagagccctcgctcaaactctccacca
attctcacaaagcccacactgaaaagaaagaaaccaattcttcaccgaagaagaagagtc
cgcaagcggaaacaccacaatagcagtgtagtcacagaaactatttccgagaccactgag
gtgttagatgaacccttcgaagactctgactccgagagaccaatgccaagactggagcct
acgtttgagattgatgaagaagaggaggatgaggatgaaaatgagctctttcccagaggg
tactttcatcgattgtcctcacaggatgtccttaggtgtcagtcttcctctaagaggcca
tctaaagatgaggaggaggaagaggagtcagatgatgtggatgacactcctattctaaaa
ccagtatctctcttgcgaaaatgtgatgtgaacagtgcttcacttgagccagatacctct
acacctatgaaaaagaaaaagggatggcccaaaggcaagagccgaaaacctatccactgg
aagaaaagacctggacgaaaaccaggatttaaattgaatcaggaaatcatagctgtttct
acgaaagaatgcataattgagcccatagttcccattaaacctgggcgtaaacccagaact
caagaaaatgaagaaatggttgaggtaaaagaggacttgcccttgttggaagaaaggaaa
gaggagatgcatacagaagcagatgaggaggaagaggacacgactagcagtgacattaga
gccatgtccccattggacagcagcaacagccctgaggcagaacccaaagaacccgaggca
gatgaggaagatgagaaacccttggaagagcaaaggcaatctgaggaagagcctcaagag
cttgaagagcaggagcaagaggaagacgatgaagtgactgcagaggccaaccagaacgaa
gaccatgatgcagatgatgaggatgatggccatctggagtctctgaaaacaaaagagcca
gaggagcagccagccagagaagaccacaaggaggagcctggcattccggaatctttttta
gatgcaaacatgcaggacagtagggagaatacaaaggataaggatgaaactgaaccagat
tctgaagaggaacagccttcccatgaggcatctgtggtatcagagaccatgccagggtct
gaggaggaccatgaggaagactccaacactaaagaagaattaattgagctaaaagaggag
gaagagatcccacacagtgaactggacctggaaactgtacaggcagtacagtctttgact
caagaagaaagcagtgagcatgaaggagcctaccaggactgcgaggaaacccttgcagcc
tgccagaccctgcagagttacacccacactgatgaggaccctcagatgtcaatggttgaa
gactgtcatgcttccgagcataatagcccaatatcctccattccgtctcatcctagccag
tcagttcgatcagtcagcagccccagcgtgcctgctctggaaagtggctacacacagatc
agcccagagcagggatcactgtccgcaccctctatgcagaacatggagaccagccccatg
atggatgtgccttctgtatcagatcactctcagcaggtggtggacagtggcttcagtgat
ctgggcagcatcgagagtaccacagagaactatgagaatccaagcagctatgattccacc
atgggcagcagcatttgtggaaataactcctctcagagcagctgctcctatggtgggttg
tcatcttcaagcagcctcacccagaacagttgtgtcgttactcagcaaatggcaaacata
ggcaacagctgcagcatgctgcaacaaaacagtgtccagcctgctaccaactgcaatatt
aagtcacctcagacttgtgtggtggaaaggcctcccagtaaccagcagccaccaccgccg
ccaccaccaccaccaccgccgcagcagcagcaacagcaacaacagccggcaccacagcct
cccccaccacagccgcagcagcaacagcagcccccaccacctcagcagcagccccagccc
ccaccaccaccacagcagcagccgcctctgtcacagtgcagtatgaacaacagtttcact
acagctccgatgatcatggagataccagagtctggaagcactgggaacatcagcatctat
gagaggattccaggggactttggtgctggcagctactctcaaccatcggccaccttcagt
ctagccaagttgcagcagctgactaacaccattatggaccctcatgccatgccttatagt
cattctcctgctgtgacttcctatgcaaccagtgtttctctgtctaatactggactggct
ccgctagctccatctcatcccttggctggggcccctcaagcacaagccaccatgactcca
cccccaaacttggcatctcctactatgaacctcacatcacctctgctacagtgcaacatg
tctgccaccaacattggcattcctcacactcagaggttgcaagggcagatgccagtcaag
gggcacatttctatccgctccaagtctgcacctttaccctctgcaactgcacaccaacaa
cagctatatggccgcagcccaccagcagttgccatgcaggctggccctcgtgcattggct
gttcagcgtggcatgaacatgggggttaatttaatgcccactccagcctataatgtcaat
tccatgaatatgaacaccttgaatgccatgaacagctatcgaatgacacagcccatgatg
aacagcagttaccatagtaaccctgcctacatgaaccagacagcacagtatcctatgcag
atgcagatgggaatgatggggagccaggcctatacccagcagcctatgcagccaaaccct
catggaaacatgatgtacactggcccctcccatcacagctacatgaatgctgctggcgtg
cccaagcagtcacttaacggaccttacatgagaagatga

DBGET integrated database retrieval system