KEGG   Cricetulus griseus (Chinese hamster): 100753241Help
Entry
100753241         CDS       T02813                                 

Definition
acyl-CoA desaturase 1-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100753241
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100753241
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    100753241
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    100753241
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100753241
Lipid biosynthesis proteins [BR:cge01004]
 Desaturase
  First
   100753241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 568 aa AA seqDB search
MAAYSPQEIPSNFATTTIMEPHSRGQQSREEKVEKMPLHTEDIRPEMKEDIHDPSYQDEE
GPPPKLEYVWRNIFLMALLHLGALYGITLVPSSKVYTWLFGLLYNIVAALGITAGAHRLW
SHRTYKARLPMRLFLIVANTMAFQNDVYEWARDHRVHHKFSETHADPHDSRRGFFFSHVG
WLLVRKHPAVKEKGRKLDMSDLKADKLVMFQRRYYKPAVVLICIVLPTLVPWYFWGETFQ
HSLCIATFLRYAIILNFTWLVNSAAHLYGYRPYDRNIGARENVLVSVASLGEGFHNYHHT
FPYDYSASEYRWHISFTTFFIDCMAALGLAYDRKRVSKAAVLAKIKRTGDGSHKSFCSWA
KRCCSSRNRQFPPAEPCGLESSTAECCDLLTPSSREHAHPSKGPLHCQTQPVSSLRHPDS
PSRCAITTCHLCHLLVKHSCCSCTVQDAPAETKELPSKQDMQNHVIVHSGHRDSDTWQRR
TVERRNTASPRRTMLLELGTAGDRYPAGGSTRPRAYALTLPDFPPHPTQPQPVGAPTVPD
QKPKTPRSETKLEQRQTKRREAWQNQCL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctactcgccacaagagatccccagcaactttgctaccaccaccatcatggag
cctcactcccggggtcagcagagtagagaagagaaagtggagaagatgcccctccacacg
gaagacatccgccctgaaatgaaagaagatatacacgaccccagctaccaagatgaggag
gggcccccgcccaagctggagtacgtctggagaaacatcttcctcatggccctgctgcac
ttgggggccctgtatgggatcacactggttccctccagcaaggtctacacctggctcttc
ggactactctacaatatagttgccgctttgggcatcaccgcgggggctcatcgcctgtgg
agccaccgaacctacaaagcacggctgcccatgcgtctcttcctcatcgtggccaacacc
atggctttccagaatgacgtgtatgaatgggcccgagatcaccgggtccaccacaagttc
tcagaaacacacgctgaccctcatgattcccgacgcggctttttcttctctcacgtgggc
tggctgcttgtgcgcaaacacccggctgtcaaagagaagggcagaaaactggacatgtct
gacttaaaagctgataaactggtcatgttccagaggaggtactacaagccagctgtcgtg
ctcatctgcatcgtcctgcccacactggtgccctggtacttctggggtgaaacgtttcaa
cacagcttatgcattgctactttcctccggtatgctataattctcaatttcacctggctg
gtgaacagcgctgcccacctctatggatatcggccatatgacaggaatattggcgcccga
gagaatgtcctggtctcagtggcatctttgggtgagggcttccacaactaccaccacacc
tttccctatgactactctgccagtgagtaccgctggcacatcagcttcaccacgttcttc
atcgactgcatggctgccctgggcctggcttatgacaggaagagagtgtctaaggctgct
gtcttggccaagattaaaagaactggagacgggagccacaagagcttctgctcgtgggcc
aagcgctgctgcagctcacgaaacagacagtttccaccagctgagccgtgtggtctcgag
tcatccacagctgaatgctgtgacttgctcacgcccagctcccgagagcacgcacatcct
tcaaagggaccactgcactgccagactcagcctgtgtccagcctcagacacccggactcc
cccagccgctgcgccatcacaacctgccacctgtgtcacctgctggtcaaacacagttgc
tgcagctgtacggtacaggatgctcctgctgagactaaggagctgccatcaaagcaggac
atgcaaaaccacgtcatagtgcattctggtcacagggacagtgacacttggcagcgccgc
acagtggaaagaagaaacactgcatcgccacgcaggactatgctgttggagctggggacg
gcaggtgaccggtatcctgcagggggcagcacgcgcccacgtgcttatgcgctgaccttg
ccggacttcccaccccaccccactcaaccccaaccggtgggtgcacccactgtgccagat
cagaaaccaaaaacaccacgctctgaaactaaactagagcaacgtcagacgaaacgaaga
gaagcttggcaaaaccagtgtctgtaa

DBGET integrated database retrieval system