KEGG   Cricetulus griseus (Chinese hamster): 100754659Help
Entry
100754659         CDS       T02813                                 

Gene name
Ckmt1, Ckmt1b
Definition
(RefSeq) creatine kinase U-type, mitochondrial
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00330  Arginine and proline metabolism
cge01100  Metabolic pathways
Module
cge_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100754659 (Ckmt1)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     100754659 (Ckmt1)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   100754659 (Ckmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 100754659
NCBI-ProteinID: XP_003498082
UniProt: G3H0U9
Position
Un
AA seq 417 aa AA seqDB search
MAGPFSRLLSARPGLRLLALAGAGSLAAGILLRPDSVRAASERRRLYPPSAEYPDLRKHN
NCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEIFAE
LFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACT
RAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGM
ARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEKLIQER
GWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDT
AATGSVFDISNLDRLGKSEVELVQLVIDGVNYLIECERRLERGQDIRIPAPLVHGKH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcccttctcccgtctgctgtctgcccgcccgggactcaggctcctggctttg
gctggagctgggtctctagccgctgggattctgctgcgtccagattctgtacgagccgcc
agtgaacggaggagactgtatcccccgagcgctgagtacccagacctccgaaagcacaac
aactgcatggccagtcacctgaccccagcagtctatgctcggctctgcgacaagaccaca
cccactggttggacactagatcagtgcatccagactggagtggacaaccctggccacccc
ttcatcaagactgtgggcatggtggctggagatgaggagacctatgagatatttgctgaa
ctgtttgaccctgtgatccaagagcgacataatggctatgacccccgaacaatgaagcac
accactgaccttgatgccagtaaaatccgttctggctactttgacgaaaggtatgtattg
tcctcaagagtcagaactggccgaagcatcaggggactcagtctgcctccagcctgcact
cgggcagagcggcgagaggtagaacgcgtggtggtggacgcactgagcggcctgaagggt
gacctggctggacgatactataggctcagtgagatgacggaggcggaacagcaacaactt
attgacgaccattttctgtttgataagcctgtgtctccattgctgactgcagcaggaatg
gctcgggactggccagatgctcgaggaatctggcacaacaatgagaagagtttcttgatc
tgggtgaatgaggaggaccacacacgggtcatctctatggagaaaggcggcaacatgaag
agagtgtttgaaagattctgccggggcctcaaagaggtggagaagctgatccaggaacga
ggctgggagttcatgtggaatgaacgtttgggatacatcttgacctgtccatctaacctg
ggcactggacttcgggcaggagtgcacatcaaactgcccctgctaagcaaagatagccgg
ttcccaaagatcctggagaacttacggctccaaaagcgtggaactggaggagtggacact
gctgccacaggcagtgtctttgacatctctaatttggaccgacttggcaagtcagaggtg
gagctggtgcagctggtcatcgatggagtaaattatttgattgagtgtgaacggcgtctg
gagagaggacaggatattcgaatccctgcacctctcgtgcatggcaaacattaa

DBGET integrated database retrieval system