KEGG   Cricetulus griseus (Chinese hamster): 100754659Help
Entry
100754659         CDS       T02813                                 

Gene name
Ckmt1
Definition
creatine kinase, mitochondrial 1, ubiquitous
Orthology
K00933  
creatine kinase [EC:2.7.3.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cge00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 417 aa AA seqDB search
MAGPFSRLLSARPGLRLLALAGAGSLAAGILLRPDSVRAASERRRLYPPSAEYPDLRKHN
NCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEIFAE
LFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACT
RAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGM
ARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEKLIQER
GWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDT
AATGSVFDISNLDRLGKSEVELVQLVIDGVNYLIECERRLERGQDIRIPAPLVHGKH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctggtcccttctcccgtctgctgtctgcccgcccgggactcaggctcctggctttg
gctggagctgggtctctagccgctgggattctgctgcgtccagattctgtacgagccgcc
agtgaacggaggagactgtatcccccgagcgctgagtacccagacctccgaaagcacaac
aactgcatggccagtcacctgaccccagcagtctatgctcggctctgcgacaagaccaca
cccactggttggacactagatcagtgcatccagactggagtggacaaccctggccacccc
ttcatcaagactgtgggcatggtggctggagatgaggagacctatgagatatttgctgaa
ctgtttgaccctgtgatccaagagcgacataatggctatgacccccgaacaatgaagcac
accactgaccttgatgccagtaaaatccgttctggctactttgacgaaaggtatgtattg
tcctcaagagtcagaactggccgaagcatcaggggactcagtctgcctccagcctgcact
cgggcagagcggcgagaggtagaacgcgtggtggtggacgcactgagcggcctgaagggt
gacctggctggacgatactataggctcagtgagatgacggaggcggaacagcaacaactt
attgacgaccattttctgtttgataagcctgtgtctccattgctgactgcagcaggaatg
gctcgggactggccagatgctcgaggaatctggcacaacaatgagaagagtttcttgatc
tgggtgaatgaggaggaccacacacgggtcatctctatggagaaaggcggcaacatgaag
agagtgtttgaaagattctgccggggcctcaaagaggtggagaagctgatccaggaacga
ggctgggagttcatgtggaatgaacgtttgggatacatcttgacctgtccatctaacctg
ggcactggacttcgggcaggagtgcacatcaaactgcccctgctaagcaaagatagccgg
ttcccaaagatcctggagaacttacggctccaaaagcgtggaactggaggagtggacact
gctgccacaggcagtgtctttgacatctctaatttggaccgacttggcaagtcagaggtg
gagctggtgcagctggtcatcgatggagtaaattatttgattgagtgtgaacggcgtctg
gagagaggacaggatattcgaatccctgcacctctcgtgcatggcaaacattaa

DBGET integrated database retrieval system