KEGG   Cricetulus griseus (Chinese hamster): 100755033Help
Entry
100755033         CDS       T02813                                 

Definition
protein O-mannosyl-transferase 1-like
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100755033
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     100755033
Glycosyltransferases [BR:cge01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   100755033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 786 aa AA seqDB search
MLKVYCAACLDVIWEPLTSDGKWNREFTLALLPSGSVPVVSPFKYVIVLALSCVLRSLLF
CKMLRFLKRPLVVTAHINLNLVALTGLGLLTRLWQLSYPRAVVFDEVYYGQYISFYMKRI
FFLDDSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALAGALSVPM
SYQIVLELHFSHCAAMGAALLMLIENALITQSRLMLLESLLIFFNLSAVLSYLKFFNSQK
HSPFSPNWWLWLMLTGVSCSCAIGIKYMGIFTYLLVLSIAAVHAWNLIGDQTLSHMRVFG
HLIARAVALLIIPVFLYLLFFYIHLMLLYRSGPHDQIMSSAFQASLEGGLARITQGQPLE
VAFGSQVTLRNVFGKPLPCWLHSHKNTYPMIYENGRGSSHQQQVTCYPFKDINNWWIIKD
PGRHQLVVNNPPRPVRHGDIVQLVHGMTTRLLNTHDVAAPLSPHSQEVSCYIDYNISMPA
QNLWRLDIVNRESSRDTWKTILSEVRFMHVNTSAILKLSGAHLPDWGFRQLEVVGEKSRG
HHESMVWNVEEHRYGTSQEQKERELELHSPTQVDINRNLSFMARFSELQWKMLTLKNEDS
EHKYSSTPLEWVTLDTNIAYWLHPRTSAQIHLLGXXXXWASASLATVAYTLLFFWYLLRR
RRSICDLPEDTWSHWVLAGALCTGGWALNYLPFFLMERILFLYHYLPALTFQILLLPIVL
QHVSDHLCRSQLQRNVFSALVVAWYSSACHVSNMLRPLTYGDTSLSPGELRALRWKDTWD
ILIRKY
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaggtgtactgtgcagcttgtttagacgtgatttgggagcctcttacctcggat
gggaagtggaatcgtgaattcaccctcgccctccttccctccggttcagtccctgttgtt
tctcctttcaaatatgtgattgtactagctctttcctgtgtcctccggagcttgcttttc
tgcaaaatgttgcgatttttaaagcggcctctagtggtgactgctcacattaacttgaac
ttggtggctctgactggcctgggactactgaccagactgtggcagctctcctaccctcgg
gctgtagtttttgatgaagtatactatggccagtacatttccttttacatgaagcgcata
ttctttctggatgacagtggaccaccgtttggccacatgctattggccttaggaggttat
ttaggaggattcgacggtaactttttatggaaccgaattggagcagaatacagcagcaac
gtgccagtgtggtccttgcgcctgctgccagcccttgcgggggctctgtcagtacccatg
tcctaccagatcgtgttggagctccacttttcccactgtgctgccatgggagccgccctg
ctaatgctcattgaaaatgccctgatcactcagtccaggctcatgctgttggaatcctta
ctgatattctttaacctctcagctgtgctgtcctatctgaagttcttcaactcccaaaaa
cacagccctttctcaccgaactggtggctgtggctaatgctgaccggggtctcttgttcc
tgcgccattggtatcaaatacatgggaatttttacctacttgctagtgctcagcattgca
gctgtccatgcctggaacctgatcggagatcagaccttgtcacatatgcgcgtgtttggt
cacttgatcgccagagcagtggccctactgatcatcccggttttcctgtacttactattc
ttctatatccacctaatgctgctctatcgctctgggccccatgaccaaatcatgtccagc
gctttccaagccagcttggagggagggctagcccgcatcacccagggccagcccctggag
gtggcctttggttcccaggtcactctgaggaacgtcttcggcaaacccttgccttgctgg
cttcattcccacaagaacacctaccctatgatatatgagaacggccgtggcagctcccac
cagcagcaggtgacctgttaccccttcaaagacatcaataactggtggatcataaaggac
cctgggagacatcagctggtggtaaacaaccctcccaggcctgtacgccatggagacatt
gtacagcttgttcacggcatgaccacccgcctccttaacacgcatgatgttgcagcccca
ctgagtcctcactctcaagaagtctcctgttacatcgactataacatctccatgcctgct
cagaacctctggaggctggacattgtgaacagagagtccagccgggatacctggaagacc
atcttgtcggaagtgcgcttcatgcatgtgaacacgtctgccatcttgaagctgagcggg
gctcacctccctgactggggatttcggcagttggaggtggttggggagaagtcacgaggc
caccacgagagcatggtgtggaatgtggaggaacaccggtatggcacaagccaagagcag
aaggagagggagctggagctgcattcacctactcaggttgatattaacaggaacctcagc
ttcatggccagattctcggaactacagtggaagatgctgacactgaagaatgaggattct
gaacacaagtacagctccaccccgctggagtgggtcaccctggacaccaacatcgcctac
tggctacatcccaggaccagtgctcagatccacttgcttggnnnnnnnnnnnnctgggct
tcagctagccttgccacagtggcctacaccctactcttcttctggtacctgctccgccga
cgaaggagcatctgtgacctccctgaggacacctggtcccactgggtgctggctggagcc
ctatgtactggcggctgggcgctcaactacctgcccttcttcctgatggagaggattctc
ttcctttaccactacctgccggcactcaccttccagatcctgctgctgccaattgtcctg
cagcatgtcagcgaccacctgtgcaggtcccagctgcagaggaatgtcttcagtgccctg
gttgtagcctggtattcctctgcatgccatgtgtccaacatgctgcgtccactaacttat
ggggacacgtcactctcaccaggagaacttcgggcccttcgctggaaagacacctgggac
attctgatcaggaagtactag

DBGET integrated database retrieval system