KEGG   Cricetulus griseus (Chinese hamster): 100755152Help
Entry
100755152         CDS       T02813                                 

Gene name
Ncoa1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:cge00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    100755152 (Ncoa1)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100755152 (Ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 1408 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRINPSVNPGIAPAHGVTRSSSLPPSNNNMASARVNR
QQSSDLNSGSSHSNSSNNQGSFGCSPGNQIVANVALNQGQAGSQSSNPSLNLNNSPMEGT
GISLSQFMSPRRQANSGLATRARMPNNSFPPNIPTLSSPVGITSGACNNNNRSYSNIPVT
SLQGMNEGPNNSVGFSAGSPVLRQMSSQNSPSRLSMQPAKAESKDNKEIASILNEMIQSD
NSANDSKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLS
CTGTSSSASSNPSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPEKKDSTPTST
AVSVPGQAPGTASIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEK
KEQMDPCNTNPTPMTKPAPEEVKLESQSQFAADLDQFDQLLPTLEKAAQLPSLCETDRMD
SAVTGVNIKSEMMPASLQPTTARSAPRLNRLPELELEAIDNQFGQPGAGDQIPWANNTVT
AINQNKPDDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGI
DKLVQGGGLDVLSERFPPQQATPPLMMEERPALYPQPYSSPSPTASLPGPFQGMVRQKPS
LGTMPVQVTPPRGTFSPSMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLMHQNRQAIL
NQFAATAPVGMNMRSGMQQQITPQVLPRLSIPPSSGLPVQMGNPRLPQGAPQQFPYPPNY
GTNPGTPPASTSPFSQLAANPEASLATRSSMVNRGMAGNMGGQFGTGINPQMQQNVFQYP
GSGLVPQGEANFAPSLSPGSSMVPMPIPPPQSSLLQQTPPASGYQSPDMKAWQQGTMGNN
NVFSQAVQNQPSPAQPGVYNNMSITVSMAGGNANVQNMNPMMGQMQMSSLQMPGMNTVCP
EQMNDPALRHTGLYCNQLSSTDLLKTEADGNQQVQQVQVFADVQCTVNLVGGDPYLNQPG
PLGTQKPTSGPQTPQAQQKSLLQQLLTE
NT seq 4227 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcttccgaccctgcgaacccagactcacataagagaaaa
ggatcgccatgtgacacactggcatcaagtactgagaagaggcgcagggagcaagaaaat
aaatatttagaagaactagctgaattactgtctgccaacatcagtgacattgacagcttg
agtgtaaaaccagataaatgcaagattttgaagaaaacagtagatcagatacagctaatg
aagagaatggagcaagagaaatcaacaactgacgatgatgttcagaagtccgacatctca
tccagcagtcaaggggtgatagaaaaggagtccttaggccctcttcttttggaggctttg
gatggatttttttttgttgtgaattgtgaaggaagaattgtatttgtgtcagaaaatgtg
accagctacttgggatacaatcaggaggaattaatgaataccagcgtctacagcatactg
cacgtgggagatcatgcagaatttgtcaagaatctgcttccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgccgaaatagccatacatttaactgcaggatgcta
attcaccctccagacgagccaggtaccgagaaccaagaagcttgccagcgctacgaagtt
atgcagtgtttcacagtgtcacagccaaaatcaatccaagaagatggcgaagattttcag
tcatgtttgatttgtattgctcggcgattacctcggcctccagctattacaggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgataccagttccctg
agagctgctggcagaactggctgggaagatttagtaaggaaatgcatttatgcttttttt
caacctcagggcagagagccatcttatgcccgacaactgtttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtcctgacatgcaacctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacactaattctgga
atgtccattccccgaataaacccctcagtcaatcctggtatcgctccagctcatggtgtg
acccgctcatcttcattgccaccatccaacaacaacatggcctctgccagagtaaaccga
caacagagctcagaccttaatagcggcagcagtcatagcaattctagcaacaatcaaggg
agttttggatgttcacctggaaatcagattgtagccaatgttgccttaaaccagggacag
gcaggttcccagagcagtaatccctctttaaacctcaataattctcctatggaaggtaca
ggaatttccctctcgcagttcatgtctccaaggagacaggctaattctggcttggcaaca
agagccaggatgccaaacaattcatttccaccaaatattccaacattaagctccccagtt
ggcattactagtggtgcctgtaataataataaccgatcctattcaaatatcccagtaaca
tctttacaaggtatgaatgaaggacccaataactctgttggcttctctgctggttctcca
gtccttaggcagatgagctcacagaattcgcctagcagattaagtatgcaaccagcaaaa
gctgagtccaaagataacaaagagattgcatccatcttaaatgagatgatccagtctgac
aacagtgctaatgacagcaaacctctggactcaggacttctgcataacaatgacagactc
tcagatggagacagtaaatactctcaaactagtcacaaactagtgcagctgttgacaaca
actgcagaacagcagttacggcatgccgatatagacacgagctgcaaagatgtactgtct
tgcaccggcacttccagctctgcctcctctaacccttcaggaggtacctgcccctcttcc
cacagttctctgactgaacgacataaaattctgcaccggcttttacaggagggcagcccc
tcagacatcaccactttgtctgtagaacctgagaaaaaggacagtacgccaacttctact
gctgtgtcagtacctggacaagccccagggaccgccagcataaaactagaactggatgct
tcaaagaaaaaagagtcgaaagaccatcaactcctgcgctaccttttagacaaagatgaa
aaagatttaagatcaactccaaacctgagcctggatgatgtaaaggtcaaagtggaaaag
aaagaacagatggatccttgtaacacaaacccaaccccaatgaccaaacctgctcctgag
gaagttaaactggagtcccagagccagtttgcagctgaccttgaccagtttgatcagtta
ctccccacactggagaaggcagcacagttgccaagcttgtgtgagacagacaggatggac
agtgcagtcactggtgtcaacatcaagtcagagatgatgcccgcttcgcttcagcccacc
actgccagatctgcccccaggctgaacagattgcctgaactagaattggaagcaatcgat
aaccagtttggacaaccaggagcaggcgatcagattccatgggcaaataatactgtgaca
gcaataaatcagaataaaccagacgaccaatgcattagttcacaattagatgagcttctt
tgcccaccaacaacagtagaaggaagaaacgatgagaaggcccttctggaacaactggtg
tccttcctcagtggcaaagatgaaacagagctggccgagctagacagagcgctggggatc
gacaagcttgtccagggaggtggattagatgtattatctgagaggtttccgccacagcaa
gcaacaccacctctgatgatggaagaaagacccgccctctacccccagccatactcatct
ccttctcctactgccagcctccctggtcctttccaaggcatggtcaggcagaaaccttca
ctggggactatgccagttcaagtaacacctccccgaggcaccttttcacccagcatgggc
atgcagccccggcagactctaaacagacctccagctgcacccaaccagctgcgactgcag
ctacagcagcggttacagggacagcagcagctgatgcaccaaaaccggcaagcgatcctg
aaccagtttgcagcaactgcccctgttggcatgaacatgaggtcaggcatgcagcagcag
atcacgcctcaggtattgcccaggctgtccatccctccttcatctggactgccagttcag
atggggaacccccgtcttcctcagggtgctccccagcagttcccctacccaccaaactat
ggtacaaatccaggaaccccacctgcttctaccagccctttttctcagctggcagccaac
cctgaggcgtccttggccacccgcagcagcatggtgaacagaggcatggcaggaaacatg
ggaggacagtttggcactggcatcaatcctcagatgcagcagaatgtcttccagtatccg
ggatcaggactggttccccaaggggaggccaactttgccccatctctaagccctgggagc
tccatggtgccgatgccaatccctcctcctcaaagctctctgctccaacaaactccaccc
gcttctgggtaccagtcaccagacatgaaggcctggcaacaaggaacaatgggaaacaac
aatgtgttcagccaagctgtccagaaccagccatctcccgcacagccaggagtgtacaac
aacatgagcatcaccgtgtccatggcaggtggaaatgcaaacgttcagaacatgaatcca
atgatgggccagatgcaaatgagctctttgcagatgccggggatgaatactgtgtgccct
gagcagatgaatgatccagcactaagacacacaggcctctactgcaaccaactctcatcc
actgaccttctcaaaacagaagcagatgggaaccagcaggtgcaacaggttcaggtgttt
gctgacgtccagtgtacagtgaatctggtaggcggggacccttacctgaaccagcctggt
ccactgggaactcaaaaacccacatcaggaccacagaccccccaggcccagcagaagagc
ctccttcagcagctactgactgaataa

DBGET integrated database retrieval system