KEGG   Cricetulus griseus (Chinese hamster): 100755152Help
Entry
100755152         CDS       T02813                                 

Gene name
Ncoa1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04915  Estrogen signaling pathway
cge04919  Thyroid hormone signaling pathway
cge05200  Pathways in cancer
cge05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    100755152 (Ncoa1)
   04919 Thyroid hormone signaling pathway
    100755152 (Ncoa1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100755152 (Ncoa1)
   05224 Breast cancer
    100755152 (Ncoa1)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100755152 (Ncoa1)
Chromosome [BR:cge03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100755152 (Ncoa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 DUF1518 NCOA_u2 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_4
Motif
Other DBs
NCBI-GeneID: 100755152
NCBI-ProteinID: XP_007653215
UniProt: G3GXN5
Position
7
AA seq 1444 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRINPSVNPGIAPAHGVTRSSSLPPSNNNMASARVNR
QQSSDLNSGSSHSNSSNNQGSFGCSPGNQIVANVALNQGQAGSQSSNPSLNLNNSPMEGT
GISLSQFMSPRRQANSGLATRARMPNNSFPPNIPTLSSPVGITSGACNNNNRSYSNIPVT
SLQGMNEGPNNSVGFSAGSPVLRQMSSQNSPSRLSMQPAKAESKDNKEIASILNEMIQSD
NSANDSKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLS
CTGTSSSASSNPSGGTCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPEKKDSTPTST
AVSVPGQAPGTASIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEK
KEQMDPCNTNPTPMTKPAPEEVKLESQSQFAADLDQFDQLLPTLEKAAQLPSLCETDRMD
SAVTGVNIKSEMMPASLQPTTARSAPRLNRLPELELEAIDNQFGQPGAGDQIPWANNTVT
AINQNKPDDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGI
DKLVQGGGLDVLSERFPPQQATPPLMMEERPALYPQPYSSPSPTASLPGPFQGMVRQKPS
LGTMPVQVTPPRGTFSPSMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLMHQNRQAIL
NQFAATAPVGMNMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQIIQQQRAMLMRH
QSFGNSIPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEAS
LATRSSMVNRGMAGNMGGQFGTGINPQMQQNVFQYPGSGLVPQGEANFAPSLSPGSSMVP
MPIPPPQSSLLQQTPPASGYQSPDMKAWQQGTMGNNNVFSQAVQNQPSPAQPGVYNNMSI
TVSMAGGNANVQNMNPMMGQMQMSSLQMPGMNTVCPEQMNDPALRHTGLYCNQLSSTDLL
KTEADGNQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQ
LLTE
NT seq 4335 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcttccgaccctgcgaacccagactcacataagagaaaa
ggatcgccatgtgacacactggcatcaagtactgagaagaggcgcagggagcaagaaaat
aaatatttagaagaactagctgaattactgtctgccaacatcagtgacattgacagcttg
agtgtaaaaccagataaatgcaagattttgaagaaaacagtagatcagatacagctaatg
aagagaatggagcaagagaaatcaacaactgacgatgatgttcagaagtccgacatctca
tccagcagtcaaggggtgatagaaaaggagtccttaggccctcttcttttggaggctttg
gatggatttttttttgttgtgaattgtgaaggaagaattgtatttgtgtcagaaaatgtg
accagctacttgggatacaatcaggaggaattaatgaataccagcgtctacagcatactg
cacgtgggagatcatgcagaatttgtcaagaatctgcttccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgccgaaatagccatacatttaactgcaggatgcta
attcaccctccagacgagccaggtaccgagaaccaagaagcttgccagcgctacgaagtt
atgcagtgtttcacagtgtcacagccaaaatcaatccaagaagatggcgaagattttcag
tcatgtttgatttgtattgctcggcgattacctcggcctccagctattacaggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgataccagttccctg
agagctgctggcagaactggctgggaagatttagtaaggaaatgcatttatgcttttttt
caacctcagggcagagagccatcttatgcccgacaactgtttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtcctgacatgcaacctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacactaattctgga
atgtccattccccgaataaacccctcagtcaatcctggtatcgctccagctcatggtgtg
acccgctcatcttcattgccaccatccaacaacaacatggcctctgccagagtaaaccga
caacagagctcagaccttaatagcggcagcagtcatagcaattctagcaacaatcaaggg
agttttggatgttcacctggaaatcagattgtagccaatgttgccttaaaccagggacag
gcaggttcccagagcagtaatccctctttaaacctcaataattctcctatggaaggtaca
ggaatttccctctcgcagttcatgtctccaaggagacaggctaattctggcttggcaaca
agagccaggatgccaaacaattcatttccaccaaatattccaacattaagctccccagtt
ggcattactagtggtgcctgtaataataataaccgatcctattcaaatatcccagtaaca
tctttacaaggtatgaatgaaggacccaataactctgttggcttctctgctggttctcca
gtccttaggcagatgagctcacagaattcgcctagcagattaagtatgcaaccagcaaaa
gctgagtccaaagataacaaagagattgcatccatcttaaatgagatgatccagtctgac
aacagtgctaatgacagcaaacctctggactcaggacttctgcataacaatgacagactc
tcagatggagacagtaaatactctcaaactagtcacaaactagtgcagctgttgacaaca
actgcagaacagcagttacggcatgccgatatagacacgagctgcaaagatgtactgtct
tgcaccggcacttccagctctgcctcctctaacccttcaggaggtacctgcccctcttcc
cacagttctctgactgaacgacataaaattctgcaccggcttttacaggagggcagcccc
tcagacatcaccactttgtctgtagaacctgagaaaaaggacagtacgccaacttctact
gctgtgtcagtacctggacaagccccagggaccgccagcataaaactagaactggatgct
tcaaagaaaaaagagtcgaaagaccatcaactcctgcgctaccttttagacaaagatgaa
aaagatttaagatcaactccaaacctgagcctggatgatgtaaaggtcaaagtggaaaag
aaagaacagatggatccttgtaacacaaacccaaccccaatgaccaaacctgctcctgag
gaagttaaactggagtcccagagccagtttgcagctgaccttgaccagtttgatcagtta
ctccccacactggagaaggcagcacagttgccaagcttgtgtgagacagacaggatggac
agtgcagtcactggtgtcaacatcaagtcagagatgatgcccgcttcgcttcagcccacc
actgccagatctgcccccaggctgaacagattgcctgaactagaattggaagcaatcgat
aaccagtttggacaaccaggagcaggcgatcagattccatgggcaaataatactgtgaca
gcaataaatcagaataaaccagacgaccaatgcattagttcacaattagatgagcttctt
tgcccaccaacaacagtagaaggaagaaacgatgagaaggcccttctggaacaactggtg
tccttcctcagtggcaaagatgaaacagagctggccgagctagacagagcgctggggatc
gacaagcttgtccagggaggtggattagatgtattatctgagaggtttccgccacagcaa
gcaacaccacctctgatgatggaagaaagacccgccctctacccccagccatactcatct
ccttctcctactgccagcctccctggtcctttccaaggcatggtcaggcagaaaccttca
ctggggactatgccagttcaagtaacacctccccgaggcaccttttcacccagcatgggc
atgcagccccggcagactctaaacagacctccagctgcacccaaccagctgcgactgcag
ctacagcagcggttacagggacagcagcagctgatgcaccaaaaccggcaagcgatcctg
aaccagtttgcagcaactgcccctgttggcatgaacatgaggtcaggcatgcagcagcag
atcacgcctcagcctcccctgaatgctcagatgttggcacagcgtcaacgggaattgtac
agtcagcagcatcgacagaggcagattatacagcagcaaagagccatgctcatgaggcac
caaagttttgggaacagcatccctccttcatctggactgccagttcagatggggaacccc
cgtcttcctcagggtgctccccagcagttcccctacccaccaaactatggtacaaatcca
ggaaccccacctgcttctaccagccctttttctcagctggcagccaaccctgaggcgtcc
ttggccacccgcagcagcatggtgaacagaggcatggcaggaaacatgggaggacagttt
ggcactggcatcaatcctcagatgcagcagaatgtcttccagtatccgggatcaggactg
gttccccaaggggaggccaactttgccccatctctaagccctgggagctccatggtgccg
atgccaatccctcctcctcaaagctctctgctccaacaaactccacccgcttctgggtac
cagtcaccagacatgaaggcctggcaacaaggaacaatgggaaacaacaatgtgttcagc
caagctgtccagaaccagccatctcccgcacagccaggagtgtacaacaacatgagcatc
accgtgtccatggcaggtggaaatgcaaacgttcagaacatgaatccaatgatgggccag
atgcaaatgagctctttgcagatgccggggatgaatactgtgtgccctgagcagatgaat
gatccagcactaagacacacaggcctctactgcaaccaactctcatccactgaccttctc
aaaacagaagcagatgggaaccagcaggtgcaacaggttcaggtgtttgctgacgtccag
tgtacagtgaatctggtaggcggggacccttacctgaaccagcctggtccactgggaact
caaaaacccacatcaggaccacagaccccccaggcccagcagaagagcctccttcagcag
ctactgactgaataa

DBGET integrated database retrieval system