KEGG   Cricetulus griseus (Chinese hamster): 100755423Help
Entry
100755423         CDS       T02813                                 

Gene name
Ugt1a1
Definition
(RefSeq) UDP-glucuronosyltransferase 1-6
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00040  Pentose and glucuronate interconversions
cge00053  Ascorbate and aldarate metabolism
cge00140  Steroid hormone biosynthesis
cge00830  Retinol metabolism
cge00860  Porphyrin and chlorophyll metabolism
cge00980  Metabolism of xenobiotics by cytochrome P450
cge00982  Drug metabolism - cytochrome P450
cge00983  Drug metabolism - other enzymes
cge01100  Metabolic pathways
cge05204  Chemical carcinogenesis
Module
cge_M00014  Glucuronate pathway (uronate pathway)
cge_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:cge00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100755423 (Ugt1a1)
   00053 Ascorbate and aldarate metabolism
    100755423 (Ugt1a1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100755423 (Ugt1a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100755423 (Ugt1a1)
   00860 Porphyrin and chlorophyll metabolism
    100755423 (Ugt1a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100755423 (Ugt1a1)
   00982 Drug metabolism - cytochrome P450
    100755423 (Ugt1a1)
   00983 Drug metabolism - other enzymes
    100755423 (Ugt1a1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100755423 (Ugt1a1)
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100755423 (Ugt1a1)
Glycosyltransferases [BR:cge01003]
 Others
  Hydrophobic molecule
   100755423 (Ugt1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C
Motif
Other DBs
NCBI-GeneID: 100755423
NCBI-ProteinID: XP_007633362
Position
Un
AA seq 540 aa AA seqDB search
MQEMRNRMACLLPAPAAQRVPAGFLFLVLWGSVLGDKLLVVPQDGSHWLSMKEIVENLSQ
RGHDITVLVPEVSLLLGESKYYTRKTFPVSYDLEELQTRFRSFGNKHFAPRSQLVAPFRE
YSNNMVIIDLCFFSCQSLLKDSATLSFLRESKFDALFTDPAMPCGVILAEYLNLPSIYLF
RGFPCSLEHMLGQSPSPASYVPRFYTKLSDHMTFPQRVANFIASLLENYLYYCLYSKYEV
IASELLKRDVSLPVLHQNSLWLLRYDFVFEYPRPVMPNMIFIGGTNCKKKEELSQEFEAY
VNASGEHGIVIFSLGSMVSEIPEKKALEIAEALGRIPQTVLWRYTGPKPSNLAKNTILVK
WLPQNDLLGHPKTRAFITHSGSHGIYEGICNGIPMVMMPLFGDQMDNAKRMETRGAGISL
NVLEMTADDLENALKKVINDKSYKENIMRLSRLHKDRPIEPLDLAVFWVEYVMRHKGAPH
LRPAAHDLTWYQYHSLDVIGFLLAIVLTSFFIVYKCCAYGCRKCFGKKGRVKKSHKSKTH
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatgcgcaataggatggcttgccttctccctgcccctgcggctcagagagtt
cctgcggggtttctcttcttagtgctttggggctccgttctaggtgacaagctgctggtg
gttccccaggatggaagccactggcttagcatgaaggagatagtggagaatctcagtcaa
aggggacatgacatcacggtgctagtgccagaagtcagtttgcttttgggagaatccaaa
tactacacgaggaaaaccttcccggtgtcctatgaccttgaagagctccagacccgtttc
cgatcctttggaaacaagcactttgctccccgttcgcagctggtggctcctttcagagag
tacagcaacaacatggtcatcattgacctctgctttttcagctgtcagagcctcctgaag
gactctgccaccctcagcttcctcagggaaagcaagtttgatgctctgttcacagaccca
gccatgccctgcggtgtgatcctggctgagtatctgaacctgccctccatctatctcttc
agaggtttcccatgctctctggagcacatgcttggacaaagtccaagccccgcgtcctac
gttcccagattctacaccaagttatcagaccacatgacatttcctcaacgggtggccaat
ttcattgctagcctcttggagaactacttatattattgtctgtattcaaagtacgaagtc
atcgcctcagaactcctcaagagagatgtgtccctaccagtcttacaccagaactctctg
tggctgttacggtatgactttgtgtttgaatatccccggccagtcatgcccaacatgatc
ttcattggaggaacgaactgcaagaaaaaggaagaactttctcaggaatttgaagcctat
gtcaatgcctctggggagcatggcatcgtgattttctctttgggatccatggtctcggag
attccagagaagaaagccttggaaattgctgaggctttgggcagaattcctcagacggtc
ctgtggcgctacactggacctaaaccatcaaatcttgcgaagaatacaatacttgtaaaa
tggctaccccaaaatgatctgcttggtcatccaaagactcgggcgttcatcacacactct
ggttctcatggtatttatgaaggaatatgcaatggcattccaatggtgatgatgcccctg
tttggtgatcagatggacaatgccaagcgcatggaaactcggggagctgggatctccctg
aatgtcctggaaatgactgctgatgatttggaaaatgcccttaaaaaggtcatcaatgac
aagagctacaaggagaacatcatgcgtctgtccagactgcacaaggaccgtccgatagag
cctctggacctggctgtgttctgggtggagtacgtgatgagacacaagggggcgccacac
ctgcgcccggcggcccatgaccttacctggtaccagtaccactccttggatgtgattggc
ttcctcctggccatcgtgttgacatctttcttcattgtctataaatgctgtgcctatggc
tgcaggaaatgctttgggaaaaagggacgagttaagaaatcacacaaatccaagacccat
tga

DBGET integrated database retrieval system