KEGG   Cricetulus griseus (Chinese hamster): 100755892Help
Entry
100755892         CDS       T02813                                 

Definition
josephin-2-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100755892
Peptidases [BR:cge01002]
 Cysteine Peptidases
  Family C86
   100755892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 188 aa AA seqDB search
MSQAPEARPSPPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLALP
LRRRHWVALRQVDGIYYNLDSKLRAPEALGGEDGVRAFLTAALAQGLCEVLLVVTKEVEE
TGCWLHTS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggccccggaagcgcggccgagcccaccctcagtgtaccacgagcggcagcgg
ctagagctgtgcgcggtccacgctctcaacaacgtcctccaacaacagctctttagccag
gaagctgcagatgaaatttgcaagaggctggccccagactcccggctgaaccctcatcgc
agcctcctgggcaccggcaattatgatgtcaacgtgatcatggctgccctgcaaggcctg
ggcctggccgctgtgtggtgggacaggaggagaccgctgtcccagctggccctgccccag
gtgctaggcctgatcctgaacctaccctctcctgtgtcgctgggactgctggccctgcca
ttgcgccgccggcactgggtggccctgcgccaagtggatggcatctactataacctggac
tcaaagcttcgggcacctgaagccctagggggtgaggatggtgtcagagccttcctgaca
gctgccctggcccaaggcctgtgcgaggtgctattggtggtgaccaaggaggtagaggag
actggctgctggctgcacacaagctga

DBGET integrated database retrieval system