KEGG   Cricetulus griseus (Chinese hamster): 100756034Help
Entry
100756034         CDS       T02813                                 

Definition
protein-glutamine gamma-glutamyltransferase Z-like
Orthology
K05623  
transglutaminase 7 [EC:2.3.2.13]
Organism
cge  Cricetulus griseus (Chinese hamster)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 710 aa AA seqDB search
MDPVAALELRSVELQIPRNNEDHHTQEMGLTKLILRRGQKFSLTLTFNRPFQPQKDHLTF
VAETGPEPTELLGTRATFVLIQTRPGNVWSASDFVIDSNSLQVSIFIPASAVIGHYTLKT
EISGDQGPSVTYPLGNFILLFNPWSSEDDVYLPSETLLQEYIMSDYGFVYKGQENSITSR
PWNYGQFEEDIVDICFEILNKSLYFLRNPSRDHSQRSDVVYVCRVVSAMINSNDDSGVLQ
GNWGEDYSEGISPLEWNGSVAILRQWSARGGQPVKYGQCWVFASVMCTVMRCLGVPTRVV
SNFHSAHNTDGNLTIDTYYDRTAEMLPTQKPDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQQTSSGLFCCGPASVRAIKEGDVHLPYDTPFVFTEVNADEVIWLFEGGQVQEILAH
NTNYIGKAISTKMVGSDQRLDITSSYKYPEGSSEERSVFIKASRKLLEPRRDSSSLLDLL
GSEGFKDKPVQLQLRLARAPMWGQDLMLTLHVQRVPDRAHSQDPIGLTVRFCAQALLHGG
STRKPFWRHAVRLNVDFEKELQWPLLLPYSNYRNKLTDEKLIHVSGIAEVEETGRFILVL
KDFSLEPPQLSIEVFERAEVGKALNIYITLTNTLMVALSNCTMVLEGSGLINGQITKDLG
ILMAGHIIQIQLELYPIKAGPHQLQVLISSSEVKEIKGYKDIFIATAPAS
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgtggcagccttggagctcaggtccgtggaactgcagatccccaggaacaac
gaggaccaccacactcaggagatgggcttgacgaagctcatcctgcgccgtggccagaag
ttcagcctaacgttgaccttcaatcgacccttccagccccagaaggaccacctcaccttt
gtagctgagacaggaccagagcccacagagcttctggggacccgagccactttcgtgctc
attcagacccggcctgggaatgtctggagtgcttccgacttcgttattgacagcaactct
ctccaagtctcgattttcataccggccagtgcagtcattggccattacacactgaagaca
gagatttctggggaccagggtcctagtgtgacttacccactggggaatttcatcttactt
tttaacccatggagttcagaggacgatgtctacctgccaagtgaaacactgctgcaggag
tatatcatgagcgattacggctttgtttacaagggtcaagaaaattccatcacctccagg
ccttggaactatgggcagtttgaagaggacatcgttgatatctgctttgagatcctgaac
aagagcctctattttctaaggaacccatccagagaccattctcagaggagtgacgtggtg
tacgtatgcagggtggtgagtgccatgatcaacagcaatgacgacagtggtgtgcttcag
ggaaactggggagaggactactccgagggcatcagccctctagaatggaatggcagtgtg
gccatcttgcggcagtggtcagccaggggtgggcagcctgtgaaatatggacagtgctgg
gtctttgcatctgttatgtgcacagtaatgagatgcttaggtgttccaacacgagtcgtt
tccaatttccattctgcacataacacagatgggaacttgaccattgacacctactatgac
cgaaccgcagaaatgctaccaactcagaagccagacaaaatctggaacttccatgtctgg
aacgagtgctggatgatccggaaagaccttccaccagggtacaatggctggcaggttctg
gaccccaccccccagcaaaccagcagtgggttgttctgttgtggtccagcctctgtcaga
gccatcaaggaaggggatgtccacttgccctatgacactccttttgtgtttacggaggtg
aatgctgatgaggtcatttggctttttgagggtggccaggtccaagaaatcctagcccat
aataccaattacatcgggaaggccatcagcaccaagatggtggggtcagatcagcgcttg
gacatcaccagttcctacaagtacccagaaggatcctctgaggagcggtctgtattcatt
aaggcttcccggaaattgctggaaccaagaagggactcttcatccctcctggatctccta
gggtctgagggctttaaggataagcctgtgcagctgcaactccgcctggctagggcaccc
atgtggggccaggacctgatgctcacactacatgtccagagggtgccagacagagcccat
agtcaggaccccattggactgacggtacgcttttgtgcacaggccctgctgcatgggggc
agcacacggaaacccttctggagacatgcggtacgcttgaatgtggactttgagaaggag
ctacagtggccactcctgctgccctacagcaattataggaacaagctgacagatgaaaag
ctgatccatgtgtctggcatcgctgaggttgaagagacagggcggttcattctggtccta
aaagatttctctctggagcctccccagttatctattgaggtgtttgaaagggctgaggtg
ggcaaggccctgaacatctacatcaccctcaccaacaccctaatggtggctctgagtaac
tgcaccatggttctggagggaagtggcctcataaatgggcagataacaaaagaccttggg
attctgatggccggacacatcatccaaattcagttggaactctaccccatcaaagctggg
ccccaccagctacaagttctcatcagtagtagcgaggtcaaggagatcaaaggctacaag
gacatcttcattgctacagctccagcctcctga

DBGET integrated database retrieval system