KEGG   Cricetulus griseus (Chinese hamster): 100756274Help
Entry
100756274         CDS       T02813                                 

Gene name
Rnase1
Definition
ribonuclease, RNase A family, 1 (pancreatic)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     100756274 (Rnase1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 149 aa AA seqDB search
MSLQKSLILFPLLALLLGWVQSSLGKESAAMKFERQHMDSTVATSSSPTYCNQMMKRRNM
TQGSCKPVNTFVHESLADVHAVCSQENVKCKNGKSNCYKSHSALHITDCRLKGNAKYPNC
DYQTSQHQKHIIVACEGNPFVPVHFDASV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcagaagtccctcattctgtttccattgcttgccctgctgcttggatgggtt
cagtcttccctgggcaaggaatctgctgccatgaagttcgagcgacagcacatggactct
actgttgccaccagcagcagccccacctactgcaaccaaatgatgaagcgccggaatatg
acacaggggtcgtgcaagcctgtaaacacctttgtgcacgaatccctggcagacgtccac
gctgtctgctcccaggaaaatgtcaaatgcaagaacgggaagtctaactgctacaagagc
cactctgccctgcacatcactgactgccgcctgaagggcaacgccaagtaccccaattgc
gactaccagaccagccagcatcagaagcacatcattgtggcctgtgaggggaaccccttc
gtgccagtccactttgatgcttctgtgtag

DBGET integrated database retrieval system