KEGG   Cricetulus griseus (Chinese hamster): 100756283Help
Entry
100756283         CDS       T02813                                 

Gene name
Kat8, Myst1
Definition
K(lysine) acetyltransferase 8
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100756283 (Kat8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 458 aa AA seqDB search
MAAQGATAAVAATTSGIVGEGEPGPGENAAVEGPAGSPGRVSPPTPARGEPEVTVEIGET
YLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPLLTVDSVCLKWAPPKHKQVKLSKK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacagggagcaacagccgcagttgctgcaacgacttcgggaattgtgggggag
ggcgagcccgggcccggggaaaatgcggcagtcgaggggcctgccgggtctccgggccgc
gtttctccgccgaccccggcgcgtggcgaaccagaagtcaccgtggaaatcggagaaacg
tacctgtgccggcggcccgatagcacctggcattcagcagaagtgatccagtctagagtg
aatgaccaggagggccgagaagaattctatgtacactatgtaggcttcaacaggcgactg
gacgaatgggtggacaagaaccgactagcactgaccaagacagtgaaggatgccgtgcaa
aagaactctgagaaatacctgagtgagctggcggagcagcctgagcgcaagatcactcga
aaccaaaaacgaaagcatgatgagatcaaccacgtacagaagacctatgcagagatggac
cccaccacagcagccttggaaaaggaacatgaggcgatcaccaaagtgaaatatgtagac
aagatccacattgggaactatgaaattgatgcctggtatttctcacctttcccagaagac
tatgggaagcagcccaagctttggctctgcgagtactgcctcaagtacatgaagtatgag
aagagctaccgcttccacctgggccagtgtcagtggcggcagccccctgggaaggagatc
tatcgcaagagcaacatctctgtgtatgaagtggacggcaaagaccataagatatattgt
cagaacctgtgtctgctggctaagcttttcctggaccacaagaccttgtattttgacgtg
gagccctttgtcttttacattttgacggaagtagataggcaaggggcccacattgtcggc
tacttttccaaggagaaggaatcccccgatggaaacaatgtagcctgtatcctcaccctg
cccccctaccagaggcgtggctatgggaagtttctcattgctttcagttatgagctctcc
aagctggagagtactgtaggctctccagagaagccactgagtgacctgggaaaactcagc
taccgaagctactggtcatgggtcttgctagagatcctgcgagacttccggggcacattg
tctatcaaagatctcagccaaatgaccagcatcacccagaatgacatcatcagcaccctg
cagtccctcaacatggtcaagtactggaagggccagcacgtgatctgtgtcacacctaag
ctggtagaggaacacctcaaaagtgcccagtataagaaaccacttttaacagtggactct
gtctgcctcaagtgggcaccccccaagcacaaacaagtcaagctttctaagaagtga

DBGET integrated database retrieval system